KEGG   Drosophila simulans: Dsimw501_GD10721Help
Entry
Dsimw501_GD10721  CDS       T01065                                 

Gene name
Dsim_GD10721
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
dsi  Drosophila simulans
Pathway
dsi00340  Histidine metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Dsimw501_GD10721 (Dsim_GD10721)
Enzymes [BR:dsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     Dsimw501_GD10721 (Dsim_GD10721)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 6733834
NCBI-ProteinID: XP_002080878
FlyBase: FBgn0182485
UniProt: B4QIA3
Position
2R
AA seq 847 aa AA seqDB search
MDFKEYRQRGKEMVDYIADYLENIRERRVFPDVSPGYMRQLLPESAPIEGEPWPKIFSDV
ERIVMPGITHWQSPHMHAYFPALNSMPSLLGDMLADAINCLGFTWASSPACTELEIIVMN
WLGKMIGLPDAFLHLSSQSQGGGVLQTTASEATLVCLLAGRTRAIQRFHERHPGYQDAEI
NARLVAYCSDQAHSSVEKAALIGLVRMRYIEADEDLAMRGKLLREAIEDDIKQGLVPFWV
CATLGTTGSCSFDNLEEIGVVCAEHHLWLHVDAAYAGSAFICPEFRTWLRGIERADSIAF
NPSKWLMVHFDATALWVRDSTAVHRTFNVEPLYLQHENSGVAVDFMHWQIPLSRRFRALK
VWFVLRSYGIKGLQRHIREGVRLAQKFEALVLADHRFELPAKRHLGLVVFRIRGDNEITE
KLLKRLNHRGNLHCIPSSLKGQYVIRFTITSTHTTLDDIVKDWMEIRQVASSVLEEMNIT
ITNRVYLKETKEKNEAFGSSLLLSNSPLSPKVVNGSFAAIFDADEFLAKTYAGVRIAHQE
SPSMRRRVRGILMSGKQFSLDSHMDVVVQTTLDAGNGATRTSTTNSYGRTTSAAQATSER
QASIQEDNEESPEETELLSLCRTGNVPSPEHAHSLSTPSRSCSSSPHSLTHSLTQSSPRS
SPVNQFLPITLCAVPSQSQLSMPVAMPLPNRNVTVSVDSLLTPVTTCNVYHGKRFLEPLE
NLAQTSASFSSSIFRLPTPMATPTRESPEDPDWPAKTFSQLLLERYSSQSQSLGNNSSTE
SSSLSGGATPTPTPLSSLDELVTPLLLSFASPSQPMLSAHGTGEGQREQGSDSDATVCST
TSSMESL
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaaggaataccgccaaaggggcaaggagatggtcgactatattgcggactat
ctggagaacatccgggaacgccgagtttttccggatgtgagtcccggctacatgcgccag
ttactgccggagtccgctccgatcgaaggagaaccgtggccgaaaatattctcggatgtg
gagcggatcgtgatgccgggcataacccactggcagtcgccccacatgcacgcctacttt
ccggccctcaactccatgccttccctactgggcgacatgctggcggatgcgattaactgt
ctgggattcacctgggcgagctcgccggcctgcaccgaactggagatcatagtgatgaac
tggctgggcaagatgatcggtctgccagatgcctttctccacctgagctcccaaagtcag
ggcggcggagttctgcagaccactgccagtgaagctactctggtttgtctgctggcggga
cggactcgggcgatccagcgattccatgagcgacatccaggctaccaggatgcggagatc
aatgcccggctggtggcctactgctccgatcaggcgcactccagtgtggagaaggcggcg
ctcattggactcgtgaggatgcgttacatcgaggcggatgaggacctggcgatgcgcggc
aaactgttgcgcgaggccatcgaggatgacattaagcagggcctggtccccttctgggtc
tgcgccacgctcgggaccaccggcagctgcagcttcgataacctggaggagattggagtc
gtgtgcgcggagcaccacctgtggctccacgtggacgccgcgtacgccggtagcgccttc
atctgcccggagtttcgcacctggctgcgtggtattgagcgggcggattcgatagccttc
aatccgtccaagtggctgatggtacacttcgatgcgaccgcattgtgggttcgggatagc
accgctgtccacaggactttcaatgtggagccgctgtatctgcagcacgagaattccgga
gtggcagtggacttcatgcactggcagataccgctgagtcgccgattccgtgccctgaag
gtgtggttcgtcctgcgatcgtacgggatcaaaggactacagcgccacatccgcgagggc
gtgcgattggctcagaaattcgaagccctcgtcctggccgatcatcgtttcgagctgccc
gccaaaaggcatcttggcctggtggtattccggatacgcggcgataatgagatcaccgaa
aagttgctgaagaggctgaatcaccgcggcaacctgcattgcatcccatcgtcgctgaag
ggacagtatgtcatccggttcaccatcacctcgacgcacacgaccttggacgatatcgtc
aaggattggatggagatccgtcaggtggcctcctctgtgctggaggagatgaacatcaca
attacgaatcgcgtctatctcaaggaaaccaaggagaaaaacgaagcttttggctcgagt
cttctgctgtcgaattctccgctctcgcccaaggtggtaaacggctcctttgcggccata
ttcgatgcggatgagttcctggccaaaacctatgccggcgttcggatagcgcaccaggaa
tcgccatcgatgagacgacgtgtgcgtggcatcctcatgtcgggcaagcagttctcgctg
gactcccacatggacgtggtggttcagacgaccctggacgccggcaatggagccactcgt
accagcaccaccaactcctatggccgcaccacttcggcggcccaggcaacctcggagagg
caggccagcatccaggaggacaacgaggagtcgccggaagaaactgaattgctgtcactg
tgcaggaccggcaatgtacccagtcccgagcacgcccactccctatccactcctagtcgc
agctgtagctccagcccccactcactgacccactctctcactcaatcctcgccgcgatcc
tcaccagtcaaccaatttctacccattactttgtgcgcagtgcccagtcaaagccaactt
tcaatgcccgttgccatgcccctgcccaatcgcaatgtcaccgtgtccgtggatagcctc
ctgaccccggtcaccacctgcaacgtttaccatggcaagcggtttctggagcccctcgag
aatctcgcccagaccagtgcctccttcagcagcagcatcttccgcctgccgacacccatg
gccacgcccacccgggaatcgcctgaggatccggactggccggcgaagaccttcagccag
ctgctgctggagcgctactcctcgcagtcccagtccctgggcaataactcctcgacggag
agcagcagtctcagcggcggggccactcccacgcccactcccctgagtagcctggatgaa
ctggtgacgccactgctgctctcattcgcatccccctcgcagccgatgctctccgcccat
ggcactggggagggtcagcgggagcagggcagcgactcggatgccaccgtttgctcgaca
acctcatcgatggagtcgctttag

DBGET integrated database retrieval system