KEGG   Drosophila simulans: Dsimw501_GD11372Help
Entry
Dsimw501_GD11372  CDS       T01065                                 

Gene name
Dsim_GD11372
Definition
(RefSeq) uncharacterized protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dsi  Drosophila simulans
Pathway
dsi00480  Glutathione metabolism
dsi00980  Metabolism of xenobiotics by cytochrome P450
dsi00982  Drug metabolism - cytochrome P450
dsi00983  Drug metabolism - other enzymes
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dsimw501_GD11372 (Dsim_GD11372)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dsimw501_GD11372 (Dsim_GD11372)
   00982 Drug metabolism - cytochrome P450
    Dsimw501_GD11372 (Dsim_GD11372)
   00983 Drug metabolism - other enzymes
    Dsimw501_GD11372 (Dsim_GD11372)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dsi02000]
    Dsimw501_GD11372 (Dsim_GD11372)
Enzymes [BR:dsi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dsimw501_GD11372 (Dsim_GD11372)
Transporters [BR:dsi02000]
 Other transporters
  Pores ion channels [TC:1]
   Dsimw501_GD11372 (Dsim_GD11372)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 6735105
NCBI-ProteinID: XP_002082082
FlyBase: FBgn0183121
UniProt: B4QCE3
Position
2R
AA seq 219 aa AA seqDB search
MSGIVLYGLDISPPVRSCQLTLRALELEYEFKEVDLLAGEHRKEEYLKKNPQHTIPLLDD
NGVLVWDSHAIVCYLVGRYGKTDELYPKDLVKRARVDQRLYFDASALFMALRNICAPYFY
NNVTEISREKGDNVRDGYGHLEAFLADNPYITGDTLTVADFCCAATASSLPAFVPLEAEK
YPKVIAWLERLQELPYYEEANGVGARKYVDLLKDQLTLL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtattgtgctgtacggattggacattagtcccccagtcagatcctgccagctg
actttgcgagccctggagttggagtatgagttcaaggaggttgatcttctggccggagag
catcgcaaggaggagtatctcaagaagaatccccagcacaccattccgctgctggatgac
aatggagtgctcgtgtgggactcacatgccattgtctgctacctggtgggcaggtatggc
aagacggatgagctgtatcccaaggatctggtgaagcgggcacgggtggatcagcggctg
tacttcgatgccagtgctctgttcatggcgcttcgaaatatctgcgccccttacttttac
aataatgtcacggagatttcgcgtgaaaagggcgacaatgtgagggatggctatggccac
ttggaggccttcctggcggacaatccctacataaccggggacactctgaccgttgcggac
ttttgctgtgctgccacagcctcatctctgccggctttcgttcccctggaggcggagaag
tatccgaaggtaatcgcctggttggagcgtctccaggagttgccctactacgaggaagcc
aatggtgtgggcgccaggaagtacgtggacttgctgaaggaccagctgaccctgctataa

DBGET integrated database retrieval system