KEGG   Drosophila simulans: Dsimw501_GD11430Help
Entry
Dsimw501_GD11430  CDS       T01065                                 

Gene name
Dsim_GD11430
Definition
(RefSeq) GD11430 gene product from transcript GD11430-RA
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dsi01002]
    Dsimw501_GD11430 (Dsim_GD11430)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD11430 (Dsim_GD11430)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dsimw501_GD11430 (Dsim_GD11430)
Peptidases [BR:dsi01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dsimw501_GD11430 (Dsim_GD11430)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dsimw501_GD11430 (Dsim_GD11430)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Lipase_3
Motif
Other DBs
NCBI-GeneID: 6735218
NCBI-ProteinID: XP_016028498
UniProt: B4QDM0
Position
2R
AA seq 411 aa AA seqDB search
MYEIHNCLRSVFLATLIPGTILLSWLTGLVGLRSLQACLLIFFLIFVVLPLIFRYSVTFQ
RGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQDEDGVRVGVWHVLPSNAVRR
FKRELRVEEEVAQDPDQQLDPAPGNEHELKELSPAIRSEFPVVLPENEQLFYERLLRMPG
GTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMM
VFEYIANTTSNPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHP
FAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYR
IALDGRSRSSGPVEFHRFGASRKYGHKYLCRAPELPGLIQKFVENYRDAVY
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagattcataattgcctaaggtccgttttcttagccacactcattcccggaacg
atcctacttagttggctaactggtctggtgggtctgcgatctctgcaagcttgtctgctg
atcttcttcttgatcttcgtggtactgcctttgatctttcgctactccgtaacgttccag
cgtggcatcctctttctgacatttattaagtatcccaaaggacttgatctcaccaagccg
gaaagcgtgggtctgtatgccacacggaacttctacataaccgtaaaggatcacgatcag
gacgaggatggagtgcgagttggtgtgtggcacgtcctgcccagcaatgcagtgcgtcgt
tttaagcgcgagctgcgcgtggaggaggaagtggcccaggacccggatcagcagctggat
cctgcccctggcaacgagcacgagctgaaggagctatcgccagccatacggtctgaattt
cccgtcgtgctgccggaaaacgagcagctcttctatgagcgattgctgcggatgcccggc
ggtactgtggtcctctatctccacggaaacacagccagccgaggcagtggtcatcgatcg
gaggtgtataagctactgcggaagctcaactaccatgtgttctccttcgactacagaggc
tatgccgactccgatcccgtgcctccgacggaggaaggcgttgtgcgcgatgccatgatg
gtttttgaatacatagccaacaccacctccaatccgattgtggtgtggggccattccctt
ggcaccggagtggccacgcatctgtgcgccaagctagccagcctacgggaaagggctccc
aggggagtgatcctcgaaagcccgttcaccaacattcgggacgagatccgcatgcatccg
ttcgccaagctgtataagaatctgccctggttcaattttaccatctcgcaaccaatgtac
accaataggctgagatttgagtcggatgttcatgtcttggagttccggcaacccatcatg
atcatccatgctgaggacgatgtcgttgtgccgtttaatctgggctatcgtctgtatagg
attgcattggatggaagaagtcgatcctcgggacccgtggagttccatcgctttggggcg
agccgaaagtatggacacaaatacctctgccgagcaccggaattgccgggactgatccaa
aagtttgtggagaactaccgtgacgccgtatactag

DBGET integrated database retrieval system