KEGG   Drosophila simulans: Dsimw501_GD12680Help
Entry
Dsimw501_GD12680  CDS       T01065                                 

Gene name
Dsim_GD12680
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
dsi  Drosophila simulans
Pathway
dsi00230  Purine metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dsimw501_GD12680 (Dsim_GD12680)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     Dsimw501_GD12680 (Dsim_GD12680)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB CPT
Motif
Other DBs
NCBI-GeneID: 6737903
NCBI-ProteinID: XP_002084731
FlyBase: FBgn0184407
UniProt: B4QIY5
Position
3L
AA seq 345 aa AA seqDB search
MTSTLQEGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAE
FLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYAGILKEKAQAAGLDVHYQVKRDVPT
GTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQ
VAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDL
REIGKRLVAMEKKNPARPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA
FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcacgctacaagaaggaatcctggtcggatgcggcaacccgctgctggacatc
tccgccgttgttcccctgaacttcctgcagaagtactctatgaacgaggatgatgcgatc
ctggccgaagaccgacacatgcccatctacggggagctggtcgaaggctaccaggcggag
tttctggctggcggatccgtgcaaaattctctgagaattgctcaatggattcttcgacag
cccagggtggctgtgttctttggctgcgtcggcgaggatcggtacgccggtatcctgaag
gagaaggcgcaagccgccggactggatgttcactaccaggtgaagagggacgtgcccacg
ggaacctgtgccgtcctgatcaccggcacccaccgatcgctctgcgctaatctggcggcc
gccaacaacttcaccatcgatcacctggaggagcccagcaacaaggctctggtggataac
gcccagtactattacatttcgggcttcttcctcactgtgaacccgccaagcattatgcag
gtggcggccaccgcccatgccaaacagcgaccgttcctaatgaacctcagcgcaccattc
atatcgcaattctacatggcaccgctgctggccgccctgccttacgtggacatcatcttt
ggcaacgaggcggaggctcaggcgttcgccgaggcccagcagtggcccagcggggacctg
cgcgagattggcaagcgattggtggcgatggagaagaaaaacccggcgcggccgcgcatt
gccattctcacgcagggctgcgatcctgtactgcttattcagcaggattcggtgcaggag
ttcccggtcacgaaattggcggtgcatgaaattgtcgataccaatggcgctggggatgca
ttcgttggaggattcctatcgcagtttgtgcagggcaagtcgctggacgtctgcatcagg
tgcggaaactatgcagccgggcacattatcaagaatccgggttgcacatactccggcgaa
ccggagttcgttgagtaa

DBGET integrated database retrieval system