KEGG   Drosophila simulans: Dsimw501_GD16119Help
Entry
Dsimw501_GD16119  CDS       T01065                                 

Gene name
Dsim_GD16119
Definition
(RefSeq) uncharacterized protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
dsi  Drosophila simulans
Pathway
dsi00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    Dsimw501_GD16119 (Dsim_GD16119)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 6725441
NCBI-ProteinID: XP_016038527
FlyBase: FBgn0187755
Position
X
AA seq 635 aa AA seqDB search
MYPVAFVLLLLVAFNAGANLGRDDERFHEELVVRPLSGDHVNTYFQFTTRWHYGEKDNLY
HTQLTPRVIAELLQQFAVKELHIGLTQGLWRYETWGYPIVEATSGAEMWAWFSGANLTNR
DVDSQWKALANVFSGVLCASLNFVDNTNSIAPRHLIRPQFMPANGQRFVRYATLPREIVC
TENLTPWKKLLPCGSASGFASLLNSGHVHNTKYHSLGLKVRVLCEDHDEDNCIVELTQTA
NLVYDLRLFELSNNDFSLRRLFGMGLNGYCELAESSKIYVQRNELGERYQLVPEPVHEVK
TTRGGHSVVYSVYDMHEQFKEAGERLFNVAWLAPKSANRRRNLAKPSLPPVTVHRYLLGH
GQERGRIVTEVTNSHYDALPIMLQEVIPWYVHAYLHTLSIRRKPQRINEYGRQRLPFKLL
HYTPGKQRELPSHLEIGFMLPGQTSALISIDVDYLLLKWLEYPPDANHGHYIGSAIVSSQ
LPMGRNYSALPPEGHLFEHSFNATRPSYVLSLHTEALIVSLPTPDFSMPYNVICLACTVV
ALAFGPIHSVATKMIIVGRQTSTPKNFVKKIFNQVFRRGKAADEAAAEGEGLPAAGAAAS
DATGVASARPAISPGSPSGDQPLLEDLDEEEEEQD
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtatccggtggcgtttgtcttgctgctcctggttgcatttaatgccggcgcgaatttg
ggacgcgatgacgaacgattccacgaggagctagtggttcgtccattgtccggcgaccat
gtcaacacctactttcagttcaccacgcgctggcactacggcgaaaaggataatctttac
cacacccaattgacgccgcgagtaattgcggagctgctgcagcagtttgcggtgaaggag
ctgcacattggcctgacccaaggactgtggcgctacgagacatggggctatcccattgtg
gaggcaaccagcggtgccgagatgtgggcgtggttcagtggcgcaaatctgaccaaccgc
gatgtggatagccagtggaaggcgttggccaacgtgttctcgggcgtgttgtgcgcctcg
ttgaatttcgtcgacaatacgaatagcattgcaccgaggcacctgatccgtccacaattt
atgccagccaatggccagagattcgttcgctacgccacactgccgcgtgagatcgtgtgc
acggagaacctgacgccgtggaagaaactactgccatgtggcagtgcctcaggctttgcc
tcacttctcaactcgggtcatgtgcacaacaccaagtaccattcgctgggattgaaggtg
cgcgtgctctgcgaggatcacgatgaggacaactgcattgtggagctgacgcagacggcc
aacttggtctacgatctccgcctgttcgagctgagcaacaatgatttctcgctgcgccgc
ctgttcggcatgggactgaatggctactgtgagctggccgagagctccaagatctatgtg
cagcgcaacgagctgggcgagcgctatcagctggttccggaacccgtgcacgaggtgaag
accacgcgtggtgggcatagtgtcgtctactccgtctacgatatgcacgagcagttcaag
gaggccggcgaacggctgtttaatgtcgcctggttggcgccaaagagcgcaaatcgtcgt
cgtaatctggcgaagccatcgctgccaccggtgacggttcatcgctatctattggggcac
ggccaggagcgcggcaggatcgttacggaggtgacgaactcgcactacgacgccctgccc
ataatgctgcaggaggtgataccgtggtatgtgcacgcctatttgcacaccctttccata
cgccgcaagccgcagcggatcaacgaatacggacgccagcgactgcccttcaagctgctc
cactatacgcccggcaagcagagggaactgccgtcccatctggaaattggcttcatgctg
cccggccagacatcggcgctgataagcatcgatgtggattatctgctgctcaaatggctg
gagtatccgccggatgcgaatcacggccactacatcggctcggccatcgtgtccagccaa
ctgccgatgggcagaaactacagcgctctgccgccggaggggcatctcttcgagcattcg
ttcaatgcgacacggccgagttatgtgctcagtttgcacacggaagcgctgattgtctcg
ctgcccacgccggacttcagcatgccgtacaatgtgatctgtctcgcgtgcacagtggtt
gccctggccttcggacccatacacagtgtggccaccaagatgatcattgtcggtcgtcag
acgtcgacgccgaagaactttgttaagaagatcttcaaccaggttttccggcgcggcaag
gccgccgatgaggcagcagccgagggcgaaggattgccagcggcaggagcagcagcatcg
gatgcaactggagttgcatcggcgagacccgcgatatcgccaggcagtccatcgggcgac
cagccgctgctggaggatctcgacgaggaggaggaggagcaggactag

DBGET integrated database retrieval system