KEGG   Drosophila simulans: Dsimw501_GD16214Help
Entry
Dsimw501_GD16214  CDS       T01065                                 

Gene name
Dsim_GD16214
Definition
(RefSeq) uncharacterized protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dsi  Drosophila simulans
Pathway
dsi00010  Glycolysis / Gluconeogenesis
dsi00562  Inositol phosphate metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD16214 (Dsim_GD16214)
   00562 Inositol phosphate metabolism
    Dsimw501_GD16214 (Dsim_GD16214)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dsimw501_GD16214 (Dsim_GD16214)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dsimw501_GD16214 (Dsim_GD16214)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6725251
NCBI-ProteinID: XP_016038261
FlyBase: FBgn0187842
Position
X
AA seq 452 aa AA seqDB search
MLSQFYCLFLLLLHFFVGVTSEEGECRRLNRADIEGRLSTKTPYRAIANYDETPPKYAGC
HPTRIWSIIRHGTRNPSESVILQAQNRLSEIKKRILDQTTPPICTAELKKLRQWHWMHLN
ATEDEKLLVAEGEDELIELAERMQRRFPDLLPELYNPEWYYFKYTATQRTLKSAESFATG
LFGRHRIHTVRYPPPLHEDPVLRFYKGCGKWKTDVDKNPETLVNARRFLAEPQMQSAVEQ
VRSSTRLPDLQPEDVQLMYTVCAFETAWHRPRRDSGSKSSYESVWCNFFDVAALEALEFF
EDLEYYWNDGYGYELTHRIACPAIADMFAAISSSEETRQRRANATLYFTHSGTLLKLLAH
LGLARDKKPLTHKHFASERLWRTSQIDAFATNLAFLRYDCDKGKPQVLVLHQERVVRLPG
CPQDQDLCPLATLRRIYANSVDHCDREKMCRV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctaagccaattttactgtttgtttttgttgctcctccacttcttcgtgggcgtgacg
tctgaagagggggagtgccggcgccttaatcgcgcagatatcgagggcagactgtccaca
aagacgccctacagagcgatcgccaattacgacgaaacgccaccgaaatacgccggctgc
catccgactcgaatttggtccatcatccgacacggaactcgaaatcccagcgaatccgtt
atccttcaggcgcaaaatcggctatcagagataaagaaacgcattctggatcagacgacg
ccgccgatctgcaccgctgaattgaaaaagctgcgccaatggcactggatgcatctgaat
gccaccgaagatgagaaattactggtggccgagggtgaggatgagctgattgagctggcg
gaacggatgcagcggcgatttccggatctacttccggagttgtacaatccggagtggtac
tactttaagtatactgcgacccaaagaacgctgaaaagtgcggaaagcttcgctacgggc
ttgttcggccgtcatcgcatccatactgtacgatatccgccgcctttgcacgaggatcct
gttttgcggttctataagggctgtggaaagtggaaaactgacgtcgataagaatcccgaa
accttggtcaacgcacgcaggttcctagcagagccgcagatgcagtcagcagtggagcag
gtacggagcagcacccggctaccggatcttcagccggaggacgttcagcttatgtacacg
gtgtgcgctttcgaaacagcctggcatcgcccacgtcgcgactccggctccaaatcttca
tacgaatccgtgtggtgtaacttctttgacgtggccgccttggaggcgctggagttcttc
gaggatctggagtactattggaacgatggctacggctacgaactgactcatcgcattgcc
tgtccggcaatcgcagatatgtttgcggccattagttcctctgaggagacacggcagcga
cgggccaacgccacgctgtacttcacgcactcgggtacgcttctcaaattgctggcccac
ctgggattggcccgggacaagaagccgctgacgcacaaacactttgccagcgagcgtctt
tggcgcacaagccagattgacgcgttcgcgaccaacttggccttcctacgttacgactgc
gataaggggaagccgcaagtcctggtgctgcaccaggagcgagtggtgcgcctgcccggc
tgcccgcaggaccaggatctctgtccgctggccacgctgcgtcgcatttacgccaatagc
gtcgaccactgcgaccgcgagaagatgtgccgagtgtag

DBGET integrated database retrieval system