KEGG   Drosophila simulans: Dsimw501_GD17604Help
Entry
Dsimw501_GD17604  CDS       T01065                                 

Gene name
Dsim_GD17604
Definition
(RefSeq) uncharacterized protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dsi01001]
    Dsimw501_GD17604 (Dsim_GD17604)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsi04131]
    Dsimw501_GD17604 (Dsim_GD17604)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dsi04812]
    Dsimw501_GD17604 (Dsim_GD17604)
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD17604 (Dsim_GD17604)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dsimw501_GD17604 (Dsim_GD17604)
Protein kinases [BR:dsi01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Dsimw501_GD17604 (Dsim_GD17604)
Membrane trafficking [BR:dsi04131]
 Others
  Actin-binding proteins
   Others
    Dsimw501_GD17604 (Dsim_GD17604)
Cytoskeleton proteins [BR:dsi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Dsimw501_GD17604 (Dsim_GD17604)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD17604 (Dsim_GD17604)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 6739607
NCBI-ProteinID: XP_016030177
FlyBase: FBgn0189154
UniProt: A0A0J9RPG7
Position
3L
AA seq 1442 aa AA seqDB search
MGNQPGKLHTNPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHD
GGSPITGYTVEHRRMGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDAS
ELSDPLTVTLQRNAITVPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFS
SRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRAGHVITKARLMVQAPPKIRLPRTYE
DGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLRED
RGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGN
YIVEYFRVGWNVWLKAATTRALNTTLHDLIEGSEYKFRVKAENPYGLSEPSGESELLFIP
DPKRGITKPKSATRIAGDEKGKPKAGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSA
KRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSQSSADLVTKPTIDSSNPKLNLTLV
TTTLAPLDKSVPSPKAPRTPATSPLKLFNPKPSGAPKDRSPVQPKPQPLPTPPKEKPDKA
SPNQKRSLSPPNKRQPPPLRKSPTPPEPIKVTPALLRSAEPVQLGVNQNVRRFSGQALSP
ARNVPTLALAVASSVSAVIGEKLPTIEISAPPTPQEEEPPVPERSPSPEPTPKSQSNARR
FSRSADKHDDVHTSNEFMLVVFDKNSKVKDKARQDSFELDLEDAIQPPPISISAPDLAFL
EFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQASKSRKTSRDKLTPVPHQTPANL
RKRLGSISEAERLSFERRSEMRRQSADVVSISRKWDSRENVNEMGNLTRIHTTGQLPFET
RKDLREPEAEEEHEDGEEEHLTESTADDSEDMDLDYDEDVDVEYPPQKKLQQQSSNDLGS
DYTESTASSEQDSIEKFKMELLARTRSPSPRDLETYHPRTMGAGTFTPYRAPTPEQAAVV
LNRPVPLPSPDFVPKPILKRSSNEHVEQAVSPLPSSFASQAPTIIVPPTATVATSNPSTL
KMDLAKGIKSFFSRDKRSATEKNTEANEEISNPLERTNAAAIAADLEVKRKAKEEEELRR
KEEERLMQEEAHAAVDHYSDLVKEVGSSHKYHTPLYLDRDELKRAAAKAAAETDEEDMLT
HAEELKKRRATDGSEDLFLAPPVVRERRLSISEREQLVHVRDAASSLAFHRSPEKPESDQ
EHESPKSQQDEEPEYPTVLVVPPPKSKNKNESETESVMSEMVEARPDARGRTRLVKVKRV
IRRRVPSSTRSRDASLTRPAIADVEGSQQTSLVLSAADRDLLQKAATLAILQSEEQAHEK
VRSALSYCTDLVLFLVACYVYLFKDARLVLPILGLIIYRQLGEAVRGYVPGWLRRRFTGD
GS
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcagccgggaaagctgcacacgaatccacaaggcggtcgccccaagaagaat
gtccactggaagtccgcagagcgaccctctccgcctggccgacccatcctgacgcctgtg
gcactgccggagcagcaaccggacgtggtgaacctgcgctgggatcggccactccacgat
ggaggttcacccatcactggctatacggtggagcaccggcgcatggggtcaccccactgg
gtaagagccacgcccactcccgtggaccgctgcgatgtgtgcatcagtggactggagccg
ggatggcgttaccagtttcgttgctttgccgagaacattgtggggcgatccgatgccagc
gagctatccgatccgctgacggtgacgctgcagcgaaatgccataaccgtgccccggttc
atcgacgaactggtggacacgaatgccgtggaagacgagagaatcgagttccgcgtccgc
attcttggcgaaccgccgccggagatcaactggtttaaggacggttacgagatcttcagc
agtcgccgcaccaagatcgtcaacgacaacgaggccagtgtcctggtgatccaccaagtg
gcgctgaccgacgagggcgagataaaatgcacggccaccaaccgagcgggacatgtgatt
accaaggcaaggttgatggtgcaggctcctcccaagatccggttaccccgcacctacgag
gatggactgattgttgaggcggatgaagtgttgcgcctcaaagtgggcgtggctggacag
ccaccgcccgctattacgtggctccatgagggcgaggtcatcgctccgggtggacgcttt
gaggtctccaacacggagaagaactcgctactcaagatcgacaatgtacttcgagaagat
cgcggcgagtatatggtgaaggcttggaatcgattgggtgaggatagtacctcctttttg
gttacagtgacagccaggcccaatccaccgggtactcccaagctgaatatgtcctttggc
aagtcggccactctttcctggacggctccactcgacgacggaggctgtaagattggcaac
tacatagttgaatatttccgagtgggctggaacgtctggctgaaggcggccaccactcgg
gcactgaacaccacacttcacgatctgatagagggttccgagtacaaatttcgggtgaag
gcagagaatccatatggcctgagcgaaccgtcgggcgaatcggagctgctcttcatcccg
gatccaaagcggggaatcaccaaaccgaaatcagccacaaggatagccggagatgagaag
ggcaagcccaaggcaggagctggggggatgcaggtgccaccgcgcaggaagactttatct
cctccacggcctcaagcagatgcctccacgggcatgtcacccaagcagtcgcccagtgcg
aagcggaaaccgaagcctcagctcatagacaacgagcaactgacccatgaaatgtcctac
ggaacttcggatcatgctctaaagatggacgtgcgcaaaagtccctcgcaaagtagcgcc
gatttggttactaagcccacgatagatagttccaatccaaagcttaacctgaccctggtt
accactacactggcaccgctggacaagtctgtaccatctcccaaggcacccaggacacca
gctacctctcccttaaaactcttcaatcctaagccctctggagcccctaaagataggtca
ccagtgcagccaaaaccacagccattgcccactccgcccaaggaaaagccggataaggca
tcacccaaccagaagaggagcttaagtccacccaacaagaggcaaccaccgcctcttcgc
aagagtcccacgccaccggaacctataaaggttaccccagctctgttgaggagtgcggag
cccgttcaactgggagtcaaccagaatgtaagacgattctctggacaagccctaagcccg
gccagaaatgtgcctactctggcgttggcagtggcttccagtgtgtcagctgtaattggc
gagaagctgcccactatcgaaataagtgctccaccaacgccccaggaggaggaacctcca
gtaccagagcgcagtccgtctccagaaccaactccaaagtcccagtccaacgcaaggcgc
ttctccaggtcagccgacaaacacgacgacgttcacaccagcaatgagttcatgctggtc
gtcttcgacaagaatagcaaggtcaaggataaggccagacaagattcctttgagctggac
ctggaggacgccatccagccaccacccatttcgatttctgcgccggatctggccttccta
gagtttacaaacttgcacaccaccttcccactgcgtcgctctgttagctccacggaactc
ttgtatgaaagggccatggccaggttctacgaggcagtggaactcgagcaggcttccaag
tcccgcaagacgtcgcgggacaaactcactccggttccccaccaaacgcctgctaatctc
cgcaagcgtctgggttccatatcggaggctgaacgcttgtctttcgaaagaagaagcgag
atgcgtcgtcaatcggccgatgtggtatccatttcccgcaaatgggactccagggagaac
gtcaacgagatgggtaacctgacacgtatccacaccactggacaattgccctttgagacc
cgaaaggatcttcgggagccggaagcggaagaggaacatgaagatggagaggaggaacac
ttaactgagagcacggctgatgatagcgaggatatggatctggattatgatgaggatgtg
gacgttgagtatccgccgcaaaagaaactgcagcagcagtccagcaacgaccttggttcg
gattacacagagagcactgcatcctcggagcaggactccatcgagaagttcaagatggaa
ctgctggcccgcacgcgatcgcccagtcctcgggatctggagacctatcatccacgtacc
atgggtgctggaacctttacaccatacagggcccccactccggagcaggctgccgttgtg
ctcaaccgaccagtgcctctgccgagtccagattttgtgcccaagccgatccttaagaga
tcctctaatgagcatgtggagcaagctgttagtcccttgccgagtagttttgccagccaa
gcaccgactatcatagtgcctccaactgcaactgtagcaactagcaatccaagcaccctt
aaaatggacctggctaagggtatcaagtcctttttcagccgcgacaagagatcagccacc
gaaaagaacacagaggccaacgaggagatatccaatccattggaaagaaccaatgctgct
gccattgccgcggacttggaagtcaagagaaaagctaaggaggaggaagaactgcgtcgc
aaggaggaggagcgcctcatgcaggaggaggcccatgcagcagtggatcactacagcgat
ttggtgaaggaggtgggtagttcccacaaataccatacgcctctatatctggaccgggat
gaactgaagcgagcggctgctaaggcagcagcggaaaccgacgaggaggacatgctcacc
catgcggaggaactgaagaagagacgtgccaccgatggcagcgaagacctgtttctggct
cctccagtggtcagggagagacggctctccatctcggagcgggagcaacttgtccatgtc
cgggatgcagccagcagtctggcattccaccgatcgcccgaaaagccagaatctgaccag
gagcacgagtcgccgaaatcacaacaggatgaggaaccggagtaccccactgtgctggtg
gtgccgccacccaaatcgaagaacaagaacgaatctgagactgagagcgtcatgagcgag
atggtggaggctcgtccggatgccaggggccggactcgcttggtgaaggtgaaaagggtg
atcaggcgaagggttccatcgagcactcgatcacgtgacgcctcactcaccagacctgcg
attgcggacgtagagggcagtcagcagacatccttggtcctctccgccgccgacagggac
ttgctgcagaaagcagccactctggccatcctccagtcggaggaacaggcgcacgagaag
gttcgctcggctcttagctactgcacggacctggtcctcttcctggtcgcctgctatgtg
tacttgttcaaggacgcacgcctggtcctgcccattctgggcctcatcatctacaggcag
ctgggcgaggcggtgcggggttatgtgcccggttggctgcgccgcaggttcaccggggat
ggtagctag

DBGET integrated database retrieval system