KEGG   Drosophila simulans: Dsimw501_GD18791Help
Entry
Dsimw501_GD18791  CDS       T01065                                 

Gene name
Dsim_Hsp70Ab
Definition
(RefSeq) Heat-shock-protein-70Ab
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dsi  Drosophila simulans
Pathway
dsi03040  Spliceosome
dsi04141  Protein processing in endoplasmic reticulum
dsi04144  Endocytosis
dsi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dsi01009]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dsi03041]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
   03009 Ribosome biogenesis [BR:dsi03009]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
   03110 Chaperones and folding catalysts [BR:dsi03110]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
   04131 Membrane trafficking [BR:dsi04131]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
   03051 Proteasome [BR:dsi03051]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
   03029 Mitochondrial biogenesis [BR:dsi03029]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dsimw501_GD18791 (Dsim_Hsp70Ab)
Spliceosome [BR:dsi03041]
 Complex B
  Other components
   Prp19 complex
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
 Complex C
   Prp19-CDC5 complex
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
Ribosome biogenesis [BR:dsi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
Chaperones and folding catalysts [BR:dsi03110]
 Heat shock proteins
  HSP70 / DNAK
   Dsimw501_GD18791 (Dsim_Hsp70Ab)
Membrane trafficking [BR:dsi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
Proteasome [BR:dsi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
Mitochondrial biogenesis [BR:dsi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Dsimw501_GD18791 (Dsim_Hsp70Ab)
Exosome [BR:dsi04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dsimw501_GD18791 (Dsim_Hsp70Ab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 DUF4795 HMMR_N Phage_lysozyme HORMA
Motif
Other DBs
NCBI-GeneID: 6728451
NCBI-ProteinID: XP_002103796
FlyBase: FBgn0022481
UniProt: B4QTJ4
Position
3R
AA seq 154 aa AA seqDB search
MSTGKAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEKQRQRITSRNALESYVFNVKQA
VDQAPAGKLDEADKNSVLDKCNDTIRWLDSNTTAEKEEFDHKLEELTRHCSPIMTKMHQQ
GAGAGAGAGGPGANCGQQAGGFGGYSGPTVEEVD
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgggcaaggccaagaacatcacgatcaagaacgacaagggacgcctctcgcag
gccgagattgatcgcatggtgaacgaggctgagaagtacgccgacgaggacgagaagcag
cgccagcgcattacctctcggaatgccctggaaagctacgtcttcaatgtgaagcaggcc
gtggatcaggcacctgctggcaaactggacgaggccgacaagaactcagtcctggacaag
tgcaacgacactatccggtggcttgacagcaacaccaccgccgagaaggaggagttcgac
cacaagctggaggagctcacccgccactgctcccccatcatgaccaagatgcatcagcag
ggtgcgggagcgggagccggagctggtggtccgggagcaaactgcggccagcaggcggga
ggatttggaggctactctggacccacggtcgaggaggtcgactaa

DBGET integrated database retrieval system