KEGG   Drosophila simulans: Dsimw501_GD20759Help
Entry
Dsimw501_GD20759  CDS       T01065                                 

Gene name
Dsim_GD20759
Definition
(RefSeq) uncharacterized protein
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
dsi  Drosophila simulans
Pathway
dsi00740  Riboflavin metabolism
dsi00860  Porphyrin and chlorophyll metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dsimw501_GD20759 (Dsim_GD20759)
   00860 Porphyrin and chlorophyll metabolism
    Dsimw501_GD20759 (Dsim_GD20759)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     Dsimw501_GD20759 (Dsim_GD20759)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     Dsimw501_GD20759 (Dsim_GD20759)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD GDP_Man_Dehyd Semialdhyde_dh NAD_binding_2 adh_short Shikimate_DH KR UPF0193 TrkA_N
Motif
Other DBs
NCBI-GeneID: 6728725
NCBI-ProteinID: XP_002104060
FlyBase: FBgn0192224
UniProt: B4QVY3
Position
3R
AA seq 204 aa AA seqDB search
MQRIAIIGGTGMTGECAVDHALQKGLSVKLLYRSEKTVPERFKSKVELVKGDVTNYEDVQ
RVIEGVDAVAVILGTRNKLEATTELSRGTENLIKAMKEAKLTKFSIVMSSFLLRPLNEVP
TVFHRLNEEHQRMLDLTKACDLDWIAILPPHIADEPASAYTVVHDEAPARLVSKYDLGKF
IIDSLEQPEHYRKVCGIGKSPKSA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcattgctattattggaggaaccggcatgaccggcgagtgtgccgtggatcac
gccctgcagaagggtctgtcggtaaaattgctataccgcagcgaaaagacagttccagaa
cgcttcaagtccaaggttgaactggtcaagggggacgtgaccaactacgaggatgtgcag
cgcgttatcgagggcgtggatgcggtagctgtcatcctgggcactcgcaacaagctggag
gccaccacggagctatcccgcggcaccgagaacctcatcaaggccatgaaggaggccaaa
ctgaccaaattctctattgtcatgtcctcgtttctgctgcgcccgctcaacgaggtgccc
actgtgttccaccgcctaaacgaggagcaccagcgcatgctggacctgaccaaggcctgc
gatcttgactggatcgccattctgccgccgcacatcgccgatgaaccggcctccgcctat
accgtcgtccacgacgaggcccccgctcgtctggtgtccaaatatgacctgggaaagttc
attatcgacagcctggagcaaccggagcactaccgcaaggtttgcggcattggcaaaagc
cccaaaagtgcctag

DBGET integrated database retrieval system