KEGG   Drosophila simulans: Dsimw501_GD21450Help
Entry
Dsimw501_GD21450  CDS       T01065                                 

Gene name
Dsim_GD21450
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
dsi  Drosophila simulans
Pathway
dsi00230  Purine metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dsimw501_GD21450 (Dsim_GD21450)
Enzymes [BR:dsi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Dsimw501_GD21450 (Dsim_GD21450)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 6730077
NCBI-ProteinID: XP_002105370
FlyBase: FBgn0192884
UniProt: B4R067
Position
3R
AA seq 676 aa AA seqDB search
MACPFFRRADSLTRQPSVIAEPGGHWALEDEELSDDALTLTHLQMAIQLLTAPSNEDLNT
AVTSLVAKYRQNWPNIHKLKLDPQTFKSCANYDYLADIQELLLKMDEASASEILVLLGEE
LITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCAGEGELIFTSE
RPVIAWLLLGSLKALTRMLYKVDVNIKIEPVEGDARRYRYLFSLVKDNSQTMLMGRPTSV
SKTIPETVQRSNSSNASDLQMNSSSFCKMFPWHFIMNEQLELVQLGRGFSKLYKPYMADF
GCQATTYFDFKRPKGLTMKFRDIVRRTYTPFLIGLNNPPGAVDFPAIGLEIKGQMVHCPE
SNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKIKNS
IEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICS
RATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALK
MIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALK
INVSPTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLESFRNPALDSELPLV
EHINVAMKTISEGGDA
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtcctttctttaggcgagcggactcgctgacacgccagccctcggtcatcgcc
gagcctggtggccactgggcgctcgaggacgaggagctctcggacgacgccctgaccctc
acccacctccagatggccatacagctgctgacggcgccgtcgaacgaggatctcaacacg
gcggtcacgtctttggtggccaagtaccgccagaactggcccaatatccacaagctcaaa
ctggatccgcaaaccttcaagagctgcgccaactatgactacttggcggacatccaggag
ctgctgctgaagatggacgaggccagtgccagcgagattctggtgctgctcggcgaggag
ctgattacctgctgctgcacagggatcattgaaagagccttccgctgcctgggcaccgat
ctgcaggaattcctgggctccctcgatggcgtttacgatgtgctgaagctgcaggaggag
gacgtcaccgataccggattcgtgtgtgccggcgagggcgagctcatcttcacctcggag
cgcccggtgattgcctggttgcttctgggctccctgaaggcgctcacccgcatgctctac
aaggtggacgtgaacatcaagatcgagcccgtggagggcgatgcccggcggtatcgctac
ctcttttcgctggtcaaggacaactcgcagaccatgctgatgggtcgtcccacttccgtg
agcaaaaccatcccggaaacggtgcagcggagcaactcgagcaacgcctccgacctgcaa
atgaactcgtccagcttctgcaagatgtttccctggcacttcatcatgaacgagcagctg
gagctggtgcagttgggcaggggattcagcaagctgtacaagccctacatggcggacttt
ggttgccaagcgaccacctactttgatttcaagcgacccaagggattgaccatgaaattc
cgggacatagtgcggcgcacctacacgcccttcctgatcggcttgaataatccgccgggc
gccgtggatttcccggccattggactggagatcaagggacagatggtgcactgtcccgag
tccaattcgctgctcttcattggctcccccttcctggacggcctggatgggctgacctgc
aacggactcttcatctcggacataccgctgcacgacgccaccagggaggtaatcctggtg
ggagaacaggccagggcgcaggatggactgcgccggcgcatggacaagatcaagaacagc
attgaggaggccaactcggcggtgaccaaggagcggaagaagaacgtcagcctgctgcac
ctcatttttcccgcggagatcgccgagaagctttggctaggctcctccattgacgccaag
acgtatcccgatgtcacgatcttgttcagcgacatcgtcggcttcactagcatctgctcg
cgggccactcccttcatggtgatcagcatgctggaggggctttacaaggacttcgacgag
ttctgcgacttctttgacgtgtacaaggtggagaccatcggggatgcctactgcgtggcc
agcggactccaccgagcctccatctacgacgcccacaaggtggcctggatggccctcaag
atgatcgacgcctgctcgaagcacatcacccacgacggcgagcaaatcaaaatgaggatc
gggctgcacacgggcactgttctggcgggagtggtgggcaggaagatgcccaggtactgc
ctcttcgggcacagcgttaccatcgccaacaagttcgagtcgggcagcgaggcgctgaag
atcaatgtcagcccaaccaccaaggattggctgaccaagcacgagggctttgagttcgag
ctgcagccgcgggatccgtcgttcctgcccaaggaattccccaatcccggcggcaccgag
acatgctacttcctggagagcttccgcaacccggctttggacagcgagctgccgctggtg
gagcacatcaatgtggccatgaagaccatatccgagggcggcgatgcctag

DBGET integrated database retrieval system