KEGG   Drosophila simulans: Dsimw501_GD22036Help
Entry
Dsimw501_GD22036  CDS       T01065                                 

Gene name
Dsim_GD22036
Definition
(RefSeq) uncharacterized protein
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
dsi  Drosophila simulans
Pathway
dsi00970  Aminoacyl-tRNA biosynthesis
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dsimw501_GD22036 (Dsim_GD22036)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dsi03029]
    Dsimw501_GD22036 (Dsim_GD22036)
Enzymes [BR:dsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dsimw501_GD22036 (Dsim_GD22036)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dsimw501_GD22036 (Dsim_GD22036)
Mitochondrial biogenesis [BR:dsi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dsimw501_GD22036 (Dsim_GD22036)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln GBP
Motif
Other DBs
NCBI-GeneID: 6732264
NCBI-ProteinID: XP_002079393
FlyBase: FBgn0193449
UniProt: B4Q572 A0A0J9R238
Position
2L
AA seq 148 aa AA seqDB search
MLRLLSKRFYCKIATKSNEKATKLDFKQLTHPTKVPQTPVDAEFPDTSASEIQIDTKTIQ
LLERLSLVDLDSERALATLKSSIQFADKIAHINTDHVRPLYTVLEHQQLQLRNDQVTEGD
CRAEVLRNAKVTDEDYYVSPPGNIPLEQ
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcctgttgagtaaacgtttttactgcaaaattgcaacgaaatcgaatgaaaag
gccactaaattggacttcaagcagctaacgcatccaaccaaggtgccacagacaccagtg
gacgcggagtttcccgacaccagcgcctccgaaatccagatcgacacgaaaaccatccag
ttgctggagcggctgtcgctggtggatctggatagcgaacgggcgctggccacgctgaag
agcagcatccagtttgcagacaagattgcccacatcaatacggaccacgtgcgtccactc
tacacggtgctggagcatcagcagctccagttacgcaacgaccaggtgactgaaggcgat
tgccgggccgaagtgctccggaacgccaaggtgacagacgaggactactacgtttcgccg
ccaggcaacattccgctggagcaatga

DBGET integrated database retrieval system