KEGG   Drosophila simulans: Dsimw501_GD22962Help
Entry
Dsimw501_GD22962  CDS       T01065                                 

Gene name
Dsim_GD22962
Definition
(RefSeq) uncharacterized protein
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dsi02000]
    Dsimw501_GD22962 (Dsim_GD22962)
Transporters [BR:dsi02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   Dsimw501_GD22962 (Dsim_GD22962)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran MFS_1
Motif
Other DBs
NCBI-GeneID: 6730448
NCBI-ProteinID: XP_002077629
FlyBase: FBgn0194355
UniProt: B4Q630
Position
2L
AA seq 476 aa AA seqDB search
MPGTSDTRRLVDAQDEDDEILGTEGSFVPAFRPQDHYADEQCLMERQQDEVVLVSNEPAS
GRLFTYLVFYLLGIGTMTPWNFFVTAEDYWKYKFRNASINNTDLDEELTPLQKSFTCDLA
LTATISGTTFLLLNAIFGHHVSLRTKMLGTLWMILILFGVTTGFVEINTDTWQEQFFLIT
LIIVVLLNISAATMSGALYGVAGLFPSEFMTAVVSGQALGGILTALAFILVLAFDTGPNT
TAFIFFIVGGVLILLCIVCYVILARKPFFRYYLEGGDKYKVIRAVPSHNRSENAEGLPLE
PILRQVMSKIYLHAISLALLYTTTLSVYPAVTVLMQSEYGHSVWTDVYFLPVVNYLIFNC
GDYFGRLFAGWMERPINQNTSLLFIVVRMAFVPLFLCSNSSEHSFLPVLVKHDYSFIAMM
VMFALSNGYFTNILLIMAPKSVKQHEKELASSIMAAALSCGMAVGSLLSLVFVQML
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcaccagtgacacacgacgactggtggacgcccaggacgaggatgacgagatt
ctgggcacggagggcagcttcgttcccgcttttcgtccgcaggaccactatgcggatgag
caatgtctcatggagcgccagcaggacgaggtagttttggtgtccaacgaacccgccagt
ggacgcctcttcacctatctcgtgttctacctgctgggcattggcaccatgaccccgtgg
aatttctttgtgactgcggaagattactggaagtacaagttccggaatgcatcgattaat
aacacagacctggacgaagagctcaccccgttgcagaagagtttcacctgcgacttagct
ctcacagccactatttccgggactacatttctgctgctaaacgccattttcggacaccat
gtctccctgcgcaccaagatgttaggaacgctgtggatgatcctcatccttttcggggtt
acaactggcttcgtggagatcaacacagacacgtggcaggaacagtttttcctaatcaca
ctcatcattgtggtgctgctaaatatatctgcggctacaatgtcgggagccctctacgga
gtcgcagggctatttccctccgagtttatgaccgctgtggttagcggacaggctcttggt
ggtatcctcacagccctggccttcattcttgtgcttgcattcgacacgggtcccaatacc
actgcattcatcttcttcattgtgggaggagtgctcatcctgctttgcattgtctgctac
gtaatcctggctcgaaagcctttctttaggtactatctcgaaggtggcgacaagtacaag
gtcatccgggcagtgccctcgcacaaccggagtgaaaacgccgagggcttgccgctcgag
cctattttgcgtcaggtcatgtcaaagatctatctgcatgccatttccctagcgctcctc
tataccaccacgctgtctgtctatccggcagttacagtgctaatgcagtcagagtacggc
cacagcgtgtggacagatgtttatttcctgcccgtcgtgaactacctgatatttaactgc
ggtgactattttggtcgtctgtttgctggctggatggagcgaccaataaaccagaacact
tcgctgctatttattgtagtgcgcatggcgtttgttccgttattcctttgttcaaactcc
agcgaacacagctttctgcccgttttggtaaaacacgactattctttcatagcgatgatg
gtaatgtttgccttgtccaacggatattttaccaacatactacttataatggcgcctaaa
agcgtaaagcagcatgaaaaggagctggcttcgtcgataatggcagctgctttgagctgt
ggcatggctgtaggatcactgctcagccttgtatttgttcaaatgctttga

DBGET integrated database retrieval system