KEGG   Drosophila simulans: Dsimw501_GD22981Help
Entry
Dsimw501_GD22981  CDS       T01065                                 

Gene name
Dsim_GD22981
Definition
(RefSeq) uncharacterized protein
  KO
K07583  tRNA pseudouridine synthase 10 [EC:5.4.99.25]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dsi03016]
    Dsimw501_GD22981 (Dsim_GD22981)
Enzymes [BR:dsi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Dsimw501_GD22981 (Dsim_GD22981)
Transfer RNA biogenesis [BR:dsi03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    Dsimw501_GD22981 (Dsim_GD22981)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 6730415
NCBI-ProteinID: XP_002077596
FlyBase: FBgn0194373
UniProt: B4Q5N1
Position
2L
AA seq 500 aa AA seqDB search
MKNQDLVEYLRSCGVCEICQLRYLKARGAEYRNINETLQKLDVKLNENVENEELVIPDGI
QPSKRARLGVCSTCLGLFSKDFQNELLNSILASDFAKYDCQKIVLAICLPMSLQLRQLAM
WFALQRRFGASIDENNPPDVPIKEAVKLILHPIICEKLAKGYDANGLMINIDLTHSLEDE
EVEKLVKLNKEAFPAKASHQKRIEISRGLLEKQYQPSKVKAETYEKYFQIPCSNVEESIK
LTSIDLQGPLICVAGRYRKLSRELSHTPWILNGQRLMEDSIEEIIIRHVGPHFTEKLGKI
TFMSSGREDVDVRCLGKGRPFVLEIPNARRTCLTKDEAFAMERAVDASGMVSIHHLQVVP
REELTHIKTGEEQKKKFYRALCALHEPVSVKILEQLQISASFNIQQKTPIRVLHRRPLHT
RPRTIYSVKARVHRENPKALIIDIVTQAGTYIKELVHGEFGRTTPSLSSIIGKPMDIQAL
DVVGIDLDWPHEVDNSKQKE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaggatttagtggaatacttaaggtcctgcggggtgtgcgaaatttgccag
ctgcgttacctgaaggccagaggcgcggagtatagaaacatcaatgagactttgcaaaag
ttggatgtaaaactaaatgaaaatgtggaaaacgaagagcttgttatacccgatgggatt
caaccatctaaaagggctcgtctgggtgtttgttcaacgtgcctcggtttgttctcaaag
gactttcagaatgagctgctcaacagcattttggcatcggatttcgcgaaatacgattgc
cagaaaatcgttctggcgatttgtctaccgatgtcgcttcagttgagacagctggccatg
tggtttgccttgcaaagaagatttggagcatctatagacgaaaacaatcccccagacgtg
cccataaaagaggctgtcaagctgatcctacaccctataatctgtgaaaagctagccaag
ggttacgatgccaacggtctgatgatcaatatagaccttacgcacagtctggaggacgaa
gaggtggaaaaactggtgaaattaaacaaagaagcctttcccgccaaggcctcgcatcaa
aagcgcattgaaatttcgcgaggattactagagaaacagtatcaaccctccaaagttaag
gcggaaacctatgagaaatattttcagataccctgctctaacgtagaggaatctataaaa
cttacttctatagacctccaaggaccactgatttgtgtagctggcagatatcgaaagctc
agcagggaactttcacatactccctggattttgaatggccaaagactcatggaggacagt
atcgaggaaattataattaggcatgtcggtccccactttacagagaagctgggtaaaatc
accttcatgtcgagtggcagagaagatgtggatgtccgatgtctggggaaaggaaggcct
tttgttttagaaattccaaatgccagacggacttgcctaaccaaagatgaggcctttgca
atggaacgggctgtggatgcgtctggtatggtgtctatacatcacctccaagtcgtgcca
agagaagaattaacccacataaaaacgggagaagagcagaaaaagaaattctatcgcgct
ctttgtgccctgcatgaaccagtatcagtgaagattttggaacaactgcaaatatcagcg
agctttaacatacaacaaaagacccccatacgagttcttcatcgtcgtcctttgcacacg
cgtcccagaacaatttacagtgtcaaggccagggtgcaccgtgaaaatccgaaagccttg
atcatcgatattgtcactcaagcaggcacttacattaaagagttagttcatggcgaattt
ggcaggaccacgccatcattgtcctctattataggcaaacccatggatattcaagctcta
gatgtggtgggaatcgatttagattggccacatgaagtagataactcgaaacaaaaggaa
tag

DBGET integrated database retrieval system