KEGG   Drosophila simulans: Dsimw501_GD23420Help
Entry
Dsimw501_GD23420  CDS       T01065                                 

Gene name
Dsim_GD23420
Definition
(RefSeq) uncharacterized protein
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dsi02000]
    Dsimw501_GD23420 (Dsim_GD23420)
Transporters [BR:dsi02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   Dsimw501_GD23420 (Dsim_GD23420)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran BTP
Motif
Other DBs
NCBI-GeneID: 6731233
NCBI-ProteinID: XP_002078392
FlyBase: FBgn0194803
UniProt: B4Q4Y5
Position
2L
AA seq 458 aa AA seqDB search
MAEAKSEKSPFIGKQQAPVTLNPSWESKLPPHDSNGKGSSSVLAKLGLPAPKDKFLIVFF
IFLLHGVGTLMPWNMFITAKSYFEDFKFGPNNTVATEVSYRTHFMQNMGFASQIPNLVFN
WLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVCIVLLNVCN
GIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIFSSKRTSAIYYFVTAIL
VLLLCFDTYFALPLNKFFRHYETISRSSEKKSDSKAQLNVPYWQIFKKAAPQLFNIFLTF
FVTLSVFPAIQSNVHRSDPDFVVGPDYFTLVTCFATFNVFAMLGSLTTSWVQWPGPRFLW
VPVVLRLAFIPLFVMCNYVPPDSVRSLAVFIENDWVYWGIAIAMAYSSGYLSSLGMMYAP
QTVHTKYQTTAGMYAAAMLITGIFSGVLFSYLGPFFVV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggctaaatcggagaagtcgcctttcattggcaaacagcaggcgccggtgacg
ctgaatccctcgtgggaatccaagttgccgccccatgattccaacggcaagggatcctcg
tcggtgttggcgaaactgggcctgccagcgccaaaagataaattccttatcgtgttcttt
atattcctgctgcacggcgtgggcacgctgatgccatggaacatgttcatcacggccaag
tcctatttcgaggacttcaagttcggaccgaacaacaccgtggccactgaagtgagttac
cgcacccatttcatgcagaatatgggctttgcctcgcagattcccaacctggtcttcaac
tggctgaacatctttgtcaactttggtggtgacctgaccacccgaatcgtctacagcatc
atcttcgagatggtcattttgctggttaccattattttggccatgctcgactcctcccag
tggccgggcgtcttcttctggaccaccatggtgtgcattgtgctgctgaacgtgtgcaat
ggcatctaccagaacaccatctacggaatagtggcatcgttgcccatcaagtacaccggc
gccgtcgtcctgggctccaacatcagcggctgcttcaccaccgccatggccttgatatgc
ggtgagatcttctcgtccaagaggacctcggccatctactacttcgtgaccgccatccta
gtgctgctgctctgcttcgacacgtactttgcgctgccgctgaacaagttcttccggcac
tacgagactattagccggagcagcgaaaagaaatcggattctaaggcccaactgaacgtg
ccttactggcagatcttcaagaaagcagcgccccaactattcaacatcttcctcacgttt
ttcgttacgttgtcggttttcccggcgattcagtcgaacgtgcaccgctccgacccagat
ttcgtagtaggtccagactactttacactggtcacttgcttcgcgacctttaacgtcttc
gcaatgctgggcagcttgaccacatcgtgggtgcaatggccgggcccgaggttcctctgg
gtgccagtggtcttgcgtctggcgttcatccccctgtttgtgatgtgcaactacgttccg
ccggactcggtgcgctcactggccgtattcatcgagaacgattgggtgtactggggcatt
gccatcgcgatggcctacagctccgggtatctcagctctctgggcatgatgtacgccccg
cagacggtgcacaccaaataccagaccactgccggaatgtacgcagctgccatgctgatc
acgggcatcttctccggagtgctgttctcgtatctgggaccatttttcgtcgtgtag

DBGET integrated database retrieval system