KEGG   Drosophila simulans: Dsimw501_GD24788Help
Entry
Dsimw501_GD24788  CDS       T01065                                 

Gene name
Dsim_GD24788
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dsi01001]
    Dsimw501_GD24788 (Dsim_GD24788)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     Dsimw501_GD24788 (Dsim_GD24788)
Protein kinases [BR:dsi01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   Dsimw501_GD24788 (Dsim_GD24788)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 6740338
NCBI-ProteinID: XP_016022620
FlyBase: FBgn0196109
Position
4
AA seq 109 aa AA seqDB search
MPLFGKKDSGKKAKAKDIKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAV
KIIDKKALKGKEESLENEIRVLRRLTHPNIVQLLETYEDKSKGYWWRTL
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgtttggcaaaaaggactcgggcaagaaagccaaggcgaaggacataaaggag
ctcaataagcaagtgtcgattgaagagaagtacaatcttcacggactcctggggactgga
gccttttcagaagtacgcctagcggaaagcaaagattcgccaggcgaacattttgcagtg
aaaattatcgataagaaagctttaaagggaaaggaagaatctctggagaatgaaattcgc
gttttgagaaggttaactcatccaaatatagtgcaactcttggaaacgtatgaggacaag
tcaaagggttactggtggcgaactctttga

DBGET integrated database retrieval system