KEGG   Drosophila simulans: Dsimw501_GD25052Help
Entry
Dsimw501_GD25052  CDS       T01065                                 

Gene name
Dsim_GD25052
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
dsi  Drosophila simulans
Pathway
dsi00562  Inositol phosphate metabolism
dsi01100  Metabolic pathways
dsi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsimw501_GD25052 (Dsim_GD25052)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Dsimw501_GD25052 (Dsim_GD25052)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dsi01009]
    Dsimw501_GD25052 (Dsim_GD25052)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     Dsimw501_GD25052 (Dsim_GD25052)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     Dsimw501_GD25052 (Dsim_GD25052)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    Dsimw501_GD25052 (Dsim_GD25052)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase Y_phosphatase3 Vps36_ESCRT-II GRAM RasGAP_C
Motif
Other DBs
NCBI-GeneID: 6735870
NCBI-ProteinID: XP_002082780
FlyBase: FBgn0196364
UniProt: A0A0J9U997
Position
2R
AA seq 761 aa AA seqDB search
MDFTRFMNKFNEIERQLSPTSALRLSFDNISPETEEPPDGNKRLWGVPVPPFVSEKVVSW
IEEEFNEAPVFYNGNSVLKKVENVRMIDRYNTKNPTVGTLYLTATHLIFVEPDSNKETWI
LHMHVASIEKLPLSTTGSPLLIRCKTFLSVTFVIPKDSECHDVYTSLLKLFQPVSINKLY
CFNYQPNKDDFPKNAGWDYFKLEAEFKHMLVPNEAWTLCTMNEKYELCDTYPRQIYVPKE
ATTLMLISSSRFRSKGRLPALTYLHNNKASICRCSQPLSGFSARCLEDEQMLEAIRKTNS
NTDYMYVVDTRPRINAMANRAAGKGYENEAFYENIKFHFLGIENIHVQRASLQKVLEACE
QKSPTMSAFINALESSGWLKHIRSILDTSSFIANAVDKGVSVVVHCSDGWDRTAQVCSLA
QLMLNPYYRTIKGFQALIEKDWLAFGHKFSERCGHIQTDAREVSPIFTQFLDCTWQLMSQ
RSEAFEFNERFLLILHDHVHSCQFGTFVGNCEKDRLDLKLAERTFSLWGYMANHLNEYIN
PLYKPNVDEAIKANLAPQCIKFWRGMYSRFESGIHPREPLGDLLLDSKEHCNSLEDHVQH
LTKRIASFKNYISKSAKKLQDATSAPGKVSKELPSNEINDNKYNYDKKLSELSAADDDHP
LKASNMSFASLSLSAEQSSPPQALPEEINSVAVDWKPMRNVTTCSCSTPFDQFSKKTHCW
RCGDIFCERCIDKNVALPGHDSGKPVPVCRGCFRQMQKQSP
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggacttcacccgattcatgaacaagttcaacgagatcgagcgccaattgtccccgacc
tccgcgctgcgcctgagcttcgacaacatctcgccggagacggaggagccgccggatggc
aacaagaggctgtggggcgtgcccgtgccgcccttcgtctccgagaaggtggtctcctgg
atcgaggaggagttcaacgaggctccggtcttctacaacggcaacagtgtgctcaagaag
gtggaaaatgtgcggatgatagatcgctacaataccaaaaatcccacggtgggcaccctc
tatctgacggccacccatctgatattcgtggagcccgacagcaacaaggagacctggatc
ctgcacatgcacgtggccagcattgagaagcttcccttgagcacgacaggatctccgctg
ctcatccgctgcaagacctttctgtccgtaactttcgtcattcccaaggactccgagtgc
cacgatgtctacacctcgctgctgaaactcttccagccggtgtccatcaacaaattgtac
tgcttcaactaccagccgaacaaggatgacttccccaagaacgccggctgggactacttc
aagctggaggccgagttcaagcacatgctggtgcccaacgaggcctggacactgtgcacc
atgaacgagaagtacgagctgtgcgacacctatccgcgtcagatctacgtgcccaaggag
gccaccacgctgatgctcatcagcagctcgcgattccgctccaaggggcggctgccggcg
ctcacctatctgcacaacaacaaggcctccatctgccgctgcagccagccgctgtccgga
ttcagtgcccgctgtctggaggatgagcagatgctggaggccatacgcaagacgaattcc
aacacggactacatgtatgtggtggacacacgaccacggattaatgccatggccaacaga
gccgccggcaagggatacgagaacgaggccttctacgagaacatcaaattccacttcctc
ggcatcgagaacatccacgtgcagcgcgccagcctgcaaaaggtgctggaggcctgcgaa
cagaagtcgcccacgatgagcgccttcataaatgccctggagtcatccggctggctgaag
cacattcgctccatattggacacgtcgagcttcatcgccaacgccgtggacaagggcgtc
tcggtagtggtccactgctccgacggctgggaccgcacggcccaggtctgttcgctggcg
cagctgatgctgaacccctactaccggaccatcaagggcttccaggcgctgatcgagaag
gactggctggccttcgggcataagttcagcgagcgctgcggccacatccagacggatgcc
cgcgaggtgtcgccgatcttcacacagttcctggactgcacctggcagctaatgtcgcag
cgcagcgaggccttcgagttcaacgagcggttcctgctcatcctgcacgaccatgtgcac
tcatgtcaattcggcaccttcgtgggcaactgcgagaaggatcgcttggacctgaagctg
gccgagcgcaccttctcgctgtggggctacatggccaaccacctgaacgagtatatcaac
ccgctgtacaagccaaatgtggacgaggccatcaaggccaacctggcaccgcagtgcatc
aagttctggcgcggcatgtatagtcgcttcgagagcggcatccatccgcgggagccactg
ggcgaccttctgctcgatagcaaggagcactgcaactcgctggaggaccacgtgcagcat
ctgaccaagcgcatagccagcttcaagaactacatttccaagtcggccaagaaactgcaa
gacgccaccagcgcccctggcaaagtgagcaaggagctccccagcaacgagatcaatgac
aacaaatacaactacgataagaaacttagcgaactgtctgccgccgacgacgaccatccg
ctgaaggccagcaacatgtccttcgctagtctgtcgctgagcgcggaacaatccagtccg
ccacaggcgctgcccgaggagatcaactccgtggccgtagactggaagcccatgcgcaac
gtaaccacctgctcctgctccacgcccttcgatcagttcagcaaaaagactcactgctgg
cgctgcggggacatcttctgcgagcgctgcatagacaagaacgtggctctgccaggacac
gacagtggaaagccggtgccggtgtgccggggctgcttccggcaaatgcaaaagcaaagc
ccgtaa

DBGET integrated database retrieval system