KEGG   Drosophila simulans: Dsimw501_GD25352Help
Entry
Dsimw501_GD25352  CDS       T01065                                 

Gene name
Dsim_GD25352
Definition
(RefSeq) uncharacterized protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dsi  Drosophila simulans
Pathway
dsi00450  Selenocompound metabolism
dsi00970  Aminoacyl-tRNA biosynthesis
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dsimw501_GD25352 (Dsim_GD25352)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dsimw501_GD25352 (Dsim_GD25352)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dsi01007]
    Dsimw501_GD25352 (Dsim_GD25352)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dsi03016]
    Dsimw501_GD25352 (Dsim_GD25352)
Enzymes [BR:dsi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Dsimw501_GD25352 (Dsim_GD25352)
Amino acid related enzymes [BR:dsi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Dsimw501_GD25352 (Dsim_GD25352)
Transfer RNA biogenesis [BR:dsi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dsimw501_GD25352 (Dsim_GD25352)
 Prokaryotic type
   Other AARSs
    Dsimw501_GD25352 (Dsim_GD25352)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 GST_C_3 tRNA-synt_1 GST_C GST_C_2 Anticodon_1 GST_C_6 AAA_13
Motif
Other DBs
NCBI-GeneID: 6735188
NCBI-ProteinID: XP_002082162
FlyBase: FBgn0196649
UniProt: A0A0J9RHI7
Position
2R
AA seq 1022 aa AA seqDB search
MIIYTNEGNPLGLQLLMLAKFAKRPVKVQLVNLNDSKYKDLLVLPTLELDNGLRLFSPAA
IAKYLLVGEGQQRDEWLEWSATLLAPALAHHMAVGHKADANALPVLNALVKKLDDKLKAT
PYLAGAKPSAADIAIWSLLAPDGTLKGAQNVDNLRDWYGRVKALPEVQEVLAEQPLKDLS
FNALQQSNRYGGLHHVPLKRLSLADASKLLVDTTPTVADTVTNEEISAAKAAFTYTAPKE
IKEERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICG
TDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAF
KDVLKAGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNAT
ELIRPRCKVCNTAPVLRSSDQLFIDLPKAEPQLKDWVDKSEGGWTHNAKVITRAWLKEGL
KPRCITRDLKWGIPVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVEL
FQFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQ
ETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFSST
VPEVITTQDELVLLALINRELRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWNLL
KGTDDQKKRASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPFVTLL
LPAGHIIGKPSPLFAKLEQSFIDELKGKYGGAQDTNGAAQRQISAADLEKAVQAQADKVR
ELKASTKDKAVWQPEVTKLLDLKKQLEEAKKKTAAAAAPVATPAPSNGSQSVQDLEKAIQ
EQGDKVRKLKGSTKDKAVWQPEVNILLDLKKQLEAAQKAAKAAPAANAAPAASPAAPAAA
AQVKALEGKIAQQAEKVRTLKATGDAAVWKPEVDILLSLKNELAALTGTPAAGGQGKGKK
KK
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgataatctacacgaatgagggtaacccgctgggactgcagctgctaatgctcgccaaa
ttcgccaagcggccggtgaaggtgcagttggttaacctaaatgactccaagtacaaggac
ttgctggtgctgcccactttggagctggacaacggattgcgtctgttctcgccggcggcc
attgccaagtaccttctcgtgggcgaggggcagcagcgcgatgagtggctggaatggtct
gccacgttgctggccccggctttggcccaccacatggctgtgggccacaaggcagacgca
aacgcgctgcccgtgctgaatgccctggtcaagaagctcgatgacaagctgaaagctaca
ccctacctggctggcgccaaacccagtgccgccgacatcgccatttggtcgctccttgct
cccgatggcacactcaaaggtgcacagaatgtagacaacctgagggattggtatgggagg
gtgaaagccctacccgaagtgcaggaagttcttgccgaacagccactgaaggatctcagc
tttaatgcgcttcagcagtcaaatcgctatggtggtttgcatcacgtaccattaaaacgt
ctcagtctggcggatgcaagcaaactgcttgtggatactacgccaacggtggcggatact
gttacaaatgaggaaataagcgcggcaaaggctgcctttacttacacagctccaaaggaa
atcaaggaggagcgaactgttcttcccaagcccggtgagcgtaacgtgctcatcacctcc
gcgcttccctatgtcaacaatgtgccacatttgggcaacatcattggttgtgttctctcc
gctgatatctatgctcgttactcgcgttctgctggctacaacacactcttgatttgcggc
acggatgagtacggtacggccaccgagaacaaggcactggcagagaaccttactccccgt
gagatctgcgacaagtacttcgaactgcacaacgccatataccgctggtttggcattggc
tttgattactttggacgcaccacaacccaagagcaaacagacattgtgcaggaggcattt
aaggatgtcctcaaagctggctacatcatcacagagagtgtggagcagttgctttgccaa
aagtgcgatcgtttcctggctgatcgttttgtcgagggtacttgcccgcatcctggctgt
ggctatgaggatgcccgcggtgatcagtgcgacaagtgcggaaagctggtcaacgccact
gagctgatccgtcccagatgtaaggtgtgcaacactgccccagtgctgcgttcctccgat
cagttgttcatcgatttgccaaaggcggaaccacaactcaaggattgggttgataagtca
gagggaggatggacgcataacgccaaggtgatcacaagggcgtggttgaaggaaggcctc
aagccgcgttgcattacacgcgacctgaagtggggcattcccgttccacacgagggcttt
gagaagaaggtcttctatgtgtggtttgatgctccatttggatacgtgtccatgaccaag
cgctacacgaaggagtaccagcagtggtggcagccggccaagggaacagacgtcgagctc
ttccagttcatggcaaaggacaacgtgcccttccactcggtggtgtggcccagtgtccta
ctggccatcaacaagggacatacacttgtatcgcacatcatggcaaccgagtatttgaac
tacgaggacggcaagttcagcaagagtcggggtattggcgtattcggcaacgatgcccag
gaaactggcattccagctgatgtttggcgattctacttggcctctgcgcgtcctgaaggt
caggactccagcttcagctggaatgatctggctgcccgaaataactcggagctgctgaat
aacttgggaaactttgtgaaccgcgccttggtcttctgcgaaaagaatttcagcagcact
gttcccgaagtgatcaccactcaggatgaacttgttctgcttgcgttgataaaccgagag
ctgcgtggttacatcaactccatggagaaggccaaacttcgggatggcgttcgtcatttg
ctggccatttcccgacatggcaatggatacatgcaaagccaacagccttggaatctactc
aagggcactgatgatcaaaagaagcgagcgtctacgataattggtctctgtgtcaacatc
gcctgcctcttggcgaacctcctcttcccctacatgccaaccacggccaggactctcttt
ggccagcttaacgcaaaacagacgccgctcaatgctgagaaaccatttgtcactttgctt
ctgcccgccggtcacataatcggcaaaccatctccgctttttgccaaactggagcagtcc
ttcatcgacgaacttaagggcaagtatggtggagctcaggacacaaatggtgctgcccag
agacaaattagcgctgctgatttagaaaaagccgtgcaagctcaggccgataaagtgcgt
gagctgaaggcaagcaccaaggataaggccgtgtggcaaccggaggtgaccaaactgctg
gaccttaagaaacagctggaagaggctaagaagaagactgcagctgccgccgcgcctgtc
gcgactccagcaccatcgaatggatcacaatcagttcaggatctggagaaggccatccaa
gagcagggcgacaaagtgcgcaagcttaagggcagcacaaaagacaaagctgtgtggcag
ccggaggtaaatatcctgctggacctcaaaaagcaactggaggcggctcaaaaggcggca
aaggcagctcccgcagcaaatgcagctcctgctgcttcaccagccgccccggctgctgct
gcccaggtgaaggcattggaaggcaagattgcccagcaggccgaaaaggtcaggactctt
aaggccactggcgatgccgcagtgtggaaacccgaagttgatattctgttgtccctcaaa
aacgagctggcggcgctgactggaacaccagctgctggtggacagggcaagggcaaaaag
aagaagtag

DBGET integrated database retrieval system