KEGG   Dickeya solani IPO 2222: A4U42_03130Help
Entry
A4U42_03130       CDS       T04410                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
dso  Dickeya solani IPO 2222
Pathway
dso00230  Purine metabolism
dso00240  Pyrimidine metabolism
dso01100  Metabolic pathways
dso01110  Biosynthesis of secondary metabolites
dso01130  Biosynthesis of antibiotics
Module
dso_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
dso_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
dso_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
dso_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:dso00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A4U42_03130
   00240 Pyrimidine metabolism
    A4U42_03130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dso04131]
    A4U42_03130
Enzymes [BR:dso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     A4U42_03130
Membrane trafficking [BR:dso04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    A4U42_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ANE77684
Position
complement(774326..774757)
Genome map
AA seq 143 aa AA seqDB search
MTVERTFSIIKPNAVAKNAIGAIYARFESAGFTIIASKMLHLSREQAEGFYAEHQGKPFF
DGLVDFMTSGPIMVQVLQAENAVQRNRDIMGATNPANALAGTLRADYADSFTANAVHGSD
SVESAEREIAYFFSADEVFPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacggtagaacgtaccttctctattatcaaaccgaacgcagttgccaaaaacgcaatc
ggcgcgatttacgcccgtttcgaaagcgcgggtttcactattatcgcttctaaaatgctg
catctgagccgtgagcaggcggaaggtttctacgccgagcaccagggcaaaccgttcttt
gacggtctggtggatttcatgacttccggtccgatcatggttcaggtactgcaggccgaa
aacgcggtgcagcgtaaccgcgatatcatgggcgcgaccaatccggccaacgcactggct
ggcacgctgcgtgcggattacgccgacagcttcacagccaatgcggtgcacggctctgat
tctgtggaatctgccgagcgtgaaatcgcttatttctttagcgcggatgaagttttcccg
cgtacccgctaa

DBGET integrated database retrieval system