KEGG   Dickeya solani IPO 2222: A4U42_07195Help
Entry
A4U42_07195       CDS       T04410                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
dso  Dickeya solani IPO 2222
Pathway
dso00010  Glycolysis / Gluconeogenesis
dso00020  Citrate cycle (TCA cycle)
dso00620  Pyruvate metabolism
dso01100  Metabolic pathways
dso01110  Biosynthesis of secondary metabolites
dso01120  Microbial metabolism in diverse environments
dso01130  Biosynthesis of antibiotics
dso01200  Carbon metabolism
Module
dso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4U42_07195
   00020 Citrate cycle (TCA cycle)
    A4U42_07195
   00620 Pyruvate metabolism
    A4U42_07195
Enzymes [BR:dso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     A4U42_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ANE75136
Position
1722673..1724292
Genome map
AA seq 539 aa AA seqDB search
MQIKGITPEALTAYGIHDVREIVYNPSYDLLFTEETSPTLQGYERGIDTQLGAVAVDTGI
FTGRSPKDKYIVRDDVTRNTVWWSDQGKGKNDNHPLSQETWQHLKQLVTSQLSGKRVFVV
DAFCGANADTRLKVRFITEVAWQAHFVKNMFIRPSDEELQGFEPDFIVMNGAKCTNPQWQ
EQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGLFSIMNYLLPLKGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFEGGCYAKTINLSAEAEPDIY
HAIRRDALLENVTVLADGRVDFSDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQAAGAKAYLVNTGWNGTGKRISIKDTRGIIDAILNGSIDDAETQTLPIFDLS
IPTALPGVDPAILDPRDTYADPAQWQEKAHDLAQRFITNFDKYTDTPAGAALVSAGPKP
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaaggcattacgccagaagcactgacggcttatggcattcatgatgtccgc
gaaattgtctacaacccaagctacgatttactttttactgaagaaacatcccctacccta
caaggctatgaacgcggtatcgacacccagttgggcgccgttgccgttgataccggcatt
ttcaccggtcgctccccgaaggataagtacatcgtccgcgacgatgtgacccgcaacacc
gtctggtggtccgatcagggcaaaggcaaaaacgacaaccatccgctcagccaggaaacc
tggcaacacctgaaacagctggtcaccagccagttgtcaggcaaacgcgtgtttgtcgtt
gatgctttctgcggcgccaacgccgacacgcgcctgaaggttcgtttcatcaccgaagtc
gcctggcaggctcacttcgtgaaaaacatgtttatccgccccagcgatgaggagttgcag
ggtttcgagccggatttcatcgtgatgaacggcgcgaaatgcaccaacccgcagtggcag
gaacaggggttgaattcggaaaacttcgtggccttcaacctgactgagcgcatccagctc
atcggcggcacctggtacggcggcgagatgaagaagggtctgttctccatcatgaactac
ctgttgccgctcaaaggcatcgcgtccatgcactgttcggccaacgtgggcgaaaaaggt
gatgtggcagtgttcttcggcctgtccggcaccggcaaaaccacgctgtccaccgacccg
aaacggcagttgatcggcgatgacgaacacggctgggacgacgatggcgtgttcaacttt
gaaggcggctgctacgcgaaaaccatcaatctgtctgctgaggcagagccggatatttac
cacgccatccgccgcgatgcgctgctggaaaacgtgaccgtgttggcggatggccgtgtg
gatttcagcgacggctccaaaaccgaaaacacccgcgtgtcctacccgatctatcacatc
gataacatcgtgaagccggtttccaaagccgggcacgccaccaaggtgattttcctgacc
gccgatgccttcggcgtgttgccgccggtgtcccgcctgaccgcggaccagacccagtac
cacttcctgtccggctttaccgccaaactggcgggcaccgaacgcggcgtgactgaaccg
acgccaaccttctccgcctgcttcggcgcagcgttcctgtcgctgcacccgacgcagtac
gccgaagtgctggtgaagcgcatgcaggcggcgggcgccaaagcctacctggtcaacacc
ggctggaacggcaccggcaagcgtatctccatcaaggacacacgcggcattatcgacgcg
atcctcaatggcagcattgacgacgccgaaacccaaacgctgccgatcttcgatctgtcg
atcccgaccgcgctgccgggcgtggatccggcaattctggatccgcgcgacacctacgcc
gatccggcgcagtggcaagagaaagcgcacgatctggcgcagcgctttatcaccaatttc
gacaaatacaccgacacccctgccggtgcggcgctggtttccgccggtccgaaaccataa

DBGET integrated database retrieval system