KEGG   Dickeya solani IPO 2222: A4U42_16910Help
Entry
A4U42_16910       CDS       T04410                                 

Definition
(GenBank) glyoxylate/hydroxypyruvate reductase A
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
dso  Dickeya solani IPO 2222
Pathway
dso00260  Glycine, serine and threonine metabolism
dso00620  Pyruvate metabolism
dso00630  Glyoxylate and dicarboxylate metabolism
dso01100  Metabolic pathways
dso01110  Biosynthesis of secondary metabolites
dso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4U42_16910
   00630 Glyoxylate and dicarboxylate metabolism
    A4U42_16910
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A4U42_16910
Enzymes [BR:dso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     A4U42_16910
    1.1.1.81  hydroxypyruvate reductase
     A4U42_16910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 2-Hacid_dh
Motif
Other DBs
NCBI-ProteinID: ANE76863
Position
3944324..3945250
Genome map
AA seq 308 aa AA seqDB search
MNILYKSLAERGRQWAEIIARRYPHARFWQWPEVPDPAAVEYLVAWEASADLIASLPNLK
ALFSVGAGADQFDYTALPPSLPVARMVEPGIVSGMVEYVTFAVLGLHRDMPVYLQQQRER
RWQGHSLVPASQRRVGVMGLGELGRAVLTQLQTLGFACRGWSRTPKSLPGVACFAGDEQR
AAFLADTDILVCLLPLTPATHGILNAQLFDQLPAGAALVQVGRGAQLNHDDLLTALDNGH
LRGAVVDVTDPEPLPSAHPFWSHPALWLTPHIASQTQADSAVDALLDNIARFERGEPMVG
VIDRQRGY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctgtataaatcgctagcggaacgcgggcggcagtgggcggaaattatcgcc
cgccgttatccgcacgcccgcttctggcaatggcccgaggtgccggacccggcggcggtg
gagtatctggtagcgtgggaggcctcggcggatctgatcgccagcctgcccaatctgaaa
gcgctattttccgtcggcgccggcgccgaccaattcgactatacggcgctgccgccgtcg
ctgccggtcgcacgcatggtggagccgggcattgtcagcggcatggtggagtacgtcacc
tttgcggtgttggggctgcaccgcgacatgccggtgtatctgcaacagcagcgcgaacgg
cgctggcaagggcattcgctggtgccggcgtctcagcggcgcgtcggggtgatggggctg
ggcgaacttgggcgggcggtgctaacgcaactgcaaacgttgggtttcgcctgtcgcggc
tggagccgcacgccgaaatcactgccgggcgtggcttgttttgccggcgatgagcaacgg
gcggcgtttctggccgacaccgacattctggtgtgcctgctgccgctgacgcctgccacc
cacggcatactcaatgcgcaactgttcgatcaattaccggccggcgcggcgctggtgcag
gttggacgcggcgcgcagctcaatcacgatgacttgctgacggcgctggataacggccat
ctgcggggggcggtggtggatgtcaccgatccggagccgctgccgtcggcgcatccgttc
tggtcgcatccggcgctgtggctgacgccgcacatcgccagccaaacccaggcggacagc
gcggtggatgcgctgctggataatatcgcccgtttcgagcggggcgagccgatggtcggc
gttatcgaccggcaacggggctattga

DBGET integrated database retrieval system