KEGG   Dickeya solani IPO 2222: A4U42_17420Help
Entry
A4U42_17420       CDS       T04410                                 

Definition
(GenBank) gluconolaconase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
dso  Dickeya solani IPO 2222
Pathway
dso00053  Ascorbate and aldarate metabolism
dso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    A4U42_17420
Enzymes [BR:dso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     A4U42_17420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: ANE76956
Position
complement(4061377..4062243)
Genome map
AA seq 288 aa AA seqDB search
MLTIAAYASNELGECPLWCERTRRLYWTDIEGSELLAIQEDSEEISRWPLPERLGSFALT
DEEHLLLMGFESCLGYYDLQSGMFTMVAASPGAPGTRINDGRCDRAGNFVFSTMHDGNPV
QAIGKFHRLNAATLETETLNLPAVTIPNSICFSPDGGTMYYSDSMQGRIFCCDYHTFRNQ
RIFTEVEGGGAPDGSCIDAQGYLWNAEWGGSRVVRYSPEGEAHSILSAPAIQTTCPVLGG
SSLNTLFCTSARVGLTEPTAYDGALFSIRSPFFAGLPESRFGSAPAAT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcttactattgcagcttatgccagcaatgaactgggagagtgtcccctctggtgcgaa
aggacacgtcgcctgtactggacagatattgaggggagtgaattactcgccatccaggaa
gacagtgaagaaatcagccgttggcccttaccggaacgcctcggctcatttgcgctgacc
gatgaagaacacctactgctgatgggtttcgaatcctgcctgggttattacgatcttcag
agcgggatgtttaccatggttgccgcctcacccggtgcaccaggtacgcgtattaatgac
ggccgctgcgatcgcgcaggaaacttcgtatttagcacgatgcacgacggcaatcctgtg
caggccattggcaaatttcacaggctgaacgctgccactctggaaacggagacactgaac
ctgcctgctgtgaccatccctaacagcatctgctttagcccagatggaggcaccatgtat
tacagcgattccatgcaggggcgcattttttgctgtgattatcatacgttccgcaatcag
cgaatttttactgaagtcgaaggtggcggcgcacctgatggttcctgcattgatgcacag
ggttatctgtggaacgccgaatggggcggcagtcgggttgttcgttacagcccagagggg
gaagcgcacagtattctgtctgctcctgccatccagactacctgcccggtgctcggcggt
tcgtcactgaacacgcttttttgcaccagtgcacgtgttggacttactgaaccaaccgca
tatgacggtgcacttttcagtatccggtcaccattttttgctggattgccagaaagccgc
tttggctcggcccccgcggcaacataa

DBGET integrated database retrieval system