KEGG   Dickeya solani IPO 2222: A4U42_20285Help
Entry
A4U42_20285       CDS       T04410                                 

Definition
(GenBank) 23S rRNA (guanine(745)-N(1))-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
dso  Dickeya solani IPO 2222
Brite
KEGG Orthology (KO) [BR:dso00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dso03009]
    A4U42_20285
Enzymes [BR:dso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A4U42_20285
Ribosome biogenesis [BR:dso03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A4U42_20285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_32 Methyltransf_23 Ubie_methyltran MTS Methyltransf_29 MetW CMAS PCMT CheR Methyltransf_33 TPMT NodS PG_isomerase_N Methyltransf_18 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ANE77480
Position
complement(4738309..4739136)
Genome map
AA seq 275 aa AA seqDB search
MQKSSAPYQCPLCHQPLNVEAGRWSCGRHHFDRAREGYVNLLPVQFKRSRQPGDSAEMMQ
ARRAFLDNGHYQPLRDRVSEQLAARLQMQPGALLDIGCGEGYYTAALADKLTPQGMAVYG
LDVSKAAIQRAAKRYAQVMFCVASSQRLPFQDHSLAAVLKIYAPCNGDELARVIRPGGGL
MTVSPGPNHLLSLKARVYQEVKPHPDIDEVFPGFVLETVERLQYRMTMTGADAASLLQMT
PFAWRATPDVSEGLMAEVQFECETDFLIRFHRRDG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcttcagcgccttatcaatgccctctgtgtcatcaacccttgaatgttgaa
gctggtcgatggtcctgcggacgccatcattttgatcgcgcgcgggaagggtacgtcaat
ttgctgccggtgcagtttaaacgctccagacaaccgggagacagcgccgaaatgatgcag
gccagacgggcgtttcttgataatgggcactatcagccattacgggatcgggtatcggag
caacttgccgctcgcctgcagatgcaaccgggcgcactgctggatatcggatgtggggaa
gggtattacacagccgcgctggcggacaaactgacgccgcagggaatggcggtttatggg
ctggatgtctccaaggcagcgatacagcgtgcggcgaagcgttatgcccaggtgatgttc
tgtgtagcgtccagtcagcggctgccttttcaggaccattctctggctgcggtactgaaa
atctacgcgccctgtaacggtgatgagctggcgcgagtcatccggcctggcggcgggctg
atgacggtttctccgggacccaatcatttgctgtcccttaaggcgcgggtgtatcaggag
gtcaagccacaccctgacatagacgaagtgtttccggggtttgtgttggaaacggttgaa
cggttgcagtatcgcatgaccatgacgggagcggatgccgccagtctgctacagatgacg
ccgttcgcctggcgagccacgccggacgtgagtgaagggctgatggcggaagtgcagttc
gagtgtgaaaccgattttttgattcgttttcatcgccgcgatgggtga

DBGET integrated database retrieval system