KEGG   Dichomitus squalens: DICSQDRAFT_135846Help
Entry
DICSQDRAFT_135846 CDS       T03133                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
dsq  Dichomitus squalens
Pathway
dsq00250  Alanine, aspartate and glutamate metabolism
dsq00330  Arginine and proline metabolism
dsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DICSQDRAFT_135846
   00330 Arginine and proline metabolism
    DICSQDRAFT_135846
Enzymes [BR:dsq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     DICSQDRAFT_135846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 18835380
NCBI-ProteinID: XP_007364971
JGI: 135846
UniProt: R7T1F5
Position
Unknown
AA seq 549 aa AA seqDB search
MAFYTPQLASFKVPAIDNEPMRSYAPGSVERKGLVEALAQMEKELPFEVPCIVNGKEVKT
GKLAKQPLPADHAKHLCTYHEADQATVAAAIDGALAAKKEWESLPWNDRAAIFLKAADLV
SGKYRYKLLAATILGQGKNAWQAEIDAAAELSDFLRFGVKYVEELYSQQPVKNAAGAWNR
IEYRALEGFVLAVSPFNFTAIGGNLPGTPALVGNTVVWKPSPAATYSNYLVYKVFEEAGV
PPGVIQFVPGVPEEVVGQAIASPDFAALHFTGSTLVFKKLWKDIAQNLDIYKSYPRIVGE
TGGKNFHLVHPSAEIRNAVTQTVRGAFEYQGQKCSALSRLYVASSVWNNGFKEQLLGEVA
SLKVGPPTDFQNFIGPVIGRPAFDKIISYIKKAKDAGGEILVGGSGDDSKGFFVQPTVIL
TKDPKSVTMVEEIFGPVLTVYVYEDADFEKTLELIDTTSPYALTGAIFSTDRKALLQATN
GLRNAAGNVYYNEKCTGAVVGQQPFGGARASGTNDKAGSISIFYRFVSARSIKENFVGLE
DYLYPSNLV
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctttctacacgccccagctcgcttccttcaaagtccccgcaatcgacaatgagccc
atgcggagctatgctcctggctctgtcgaacgcaagggccttgtcgaagccctcgcacag
atggagaaggagctccctttcgaggtgccttgtattgtgaacggcaaggaggtcaagact
ggcaagctcgcgaagcagcccctccccgccgaccacgcaaagcacctctgcacgtaccac
gaagcagaccaggcgacggttgccgctgctatcgacggcgcgcttgccgcgaagaaggaa
tgggaatccctaccgtggaatgatcgcgcggccatcttcctcaaggccgcggaccttgtg
agcggaaaatatcgctacaagctcctggcggcgacgatactgggccagggcaagaacgcg
tggcaggctgagattgatgcagcagccgagctatcagacttcctccgcttcggtgtcaag
tacgtcgaggaactttactcgcagcagcctgtcaagaacgcggcgggcgcgtggaaccgc
attgagtaccgtgcacttgagggctttgtcctcgcagtctcgccgttcaactttactgcg
attggcggtaaccttccgggcactcccgctcttgtcggtaacactgtcgtctggaagccc
tcgcccgcggcgacgtactccaactacctcgtctacaaggtctttgaagaggctggggta
ccccctggtgtcattcagttcgtccctggtgttccggaggaagtcgttggccaggcgatc
gccagcccagacttcgccgccctccacttcaccggcagtaccctcgttttcaagaagctc
tggaaggacatcgctcagaacctcgacatttacaagagctatccccgcatcgtcggtgag
accggtggcaaaaacttccacctcgtccacccctctgcagagatccggaacgcggtcacg
cagaccgtccgtggggcattcgagtaccagggtcagaagtgctctgcgctatcgcgtctc
tacgttgcgtcgtccgtgtggaacaacggcttcaaggagcagctccttggggaagtcgcg
agtctcaaggttggtcctccgacggacttccagaactttatcggtcctgtcatcggccgg
cctgccttcgacaagatcatcagttacatcaagaaggcgaaagatgccggcggcgagatc
ctcgttggtggtagcggtgacgactccaagggcttcttcgtgcagcccactgtcatcctg
acgaaggacccgaagtccgtgacgatggtcgaggagatcttcggtcctgtcctgaccgtc
tacgtctacgaagatgcggactttgagaagaccctcgagctcatcgacaccacctcgccc
tacgctctcaccggcgccattttctcgacggaccgcaaggcactgctccaggcgaccaac
ggcctgcgcaacgccgcgggcaacgtgtactacaacgagaaatgcacgggtgccgtcgtc
ggccagcagccgttcggcggtgcgcgcgcgagcggcacgaacgacaaggcgggctccatc
tcgatcttctaccgcttcgtgtcggcgcggagcatcaaggagaacttcgtcgggctcgag
gactacctgtacccttcgaacctcgtctaa

DBGET integrated database retrieval system