KEGG   Dichomitus squalens: DICSQDRAFT_136396Help
Entry
DICSQDRAFT_136396 CDS       T03133                                 

Definition
(RefSeq) hypothetical protein
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
dsq  Dichomitus squalens
Pathway
dsq00780  Biotin metabolism
dsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DICSQDRAFT_136396
Enzymes [BR:dsq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     DICSQDRAFT_136396
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     DICSQDRAFT_136396
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     DICSQDRAFT_136396
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     DICSQDRAFT_136396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB ABC_transp_aux
Motif
Other DBs
NCBI-GeneID: 18835465
NCBI-ProteinID: XP_007365573
JGI: 136396
UniProt: R7T2Q6
Position
Unknown
AA seq 571 aa AA seqDB search
MNVLVYTGPDTSSPSLSHTLTSLRTLLTPNYAVQTLDAKALPTQPWPASCALLIIPPFQS
QSGAGAFSAAAAKDVQNYVRGGGKLLSLGNAVRVDPSKIPTALALSAQVAGVSISDVSPT
PASAPRPKLTLEDGDVGLAFSLAPVTEGIVDAPAIRLVDGAQLDGVQSAGGVDLPTLPEA
ALSAKGVEFLAQYDPTEDSCVVAIKARIGRGVAAFWGAHLEAPLASDPARDKARLQALRR
TLDLLGLRLPSPSAAGESDNGAVARPTPQILSSAPWRIGVVETILRALEVPELAAAAPYE
FKDSNDTFLFHPQQEAARVFAEQREATKTLGEDPATWNPKHIVVYKDGMTAPQELTPKFR
IETYYEELRNARGERGCPENYPDGAWGVGEALLYGEVVTSTQTMLDKNIRLLTSLPTPLL
SLASAQLTGRGRGGNVWLSPPGCLQFSLLLRAPLSALPATKIVFVQYLFALAVAEACRTD
GVLGEEAGSRVRIKWPNDLYAITPDGERKKIGGILVNTSFGAGKVELVVGASSALRSRRL
TLTSTPTFHRAWMNMTFTRSCVHAACPQGAA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcctcgtctacactggccccgacacctcctcgccctccctctcgcacaccctc
acctccctccgcaccctcctcaccccaaactacgccgtccaaacgctcgatgcaaaagcc
ctacctacccagccctggcctgcgtcctgcgcgctcctcatcatcccccccttccaaagc
caaagcggagcgggcgcgttctccgctgccgcggccaaagacgtccagaactacgtccgc
gggggcgggaagctcctctcgctgggcaacgcggtgcgcgtcgacccttcgaagatcccg
accgcgctggcgctgtcggcgcaggtcgccggcgtgagcatctccgacgtcagcccgacg
cccgcgtctgccccgcggccgaagctcacgctcgaggatggcgatgttgggctcgctttc
tcgcttgcaccggtgaccgaggggatcgtcgacgcacctgcgatacgcctcgtagatggc
gcacagctcgatggtgtccagagcgcgggcggggtggacctcccgaccctccctgaggca
gccctctcggcgaaaggcgtcgagttcctcgcgcaatacgacccgaccgaggactcgtgc
gttgtcgctatcaaggcgcgcatcgggcgcggggtcgcggcattctggggcgcacatctc
gaggctcctctcgcgtctgaccccgcgcgggacaaggcacgcctccaggctctacggcgc
acgctcgatttgttgggcttgcgcctgccgtcgccctcggcagcaggagaaagcgacaat
ggtgctgttgcccgcccgacgccccagatcctcagcagcgcgccgtggcgcataggtgtt
gtggagacgatccttcgtgcactcgaagtgcccgaactcgctgccgccgccccgtacgag
ttcaaagacagtaacgacaccttcctcttccacccccagcaggaagctgcgcgcgtcttt
gcggagcagcgcgaggctacgaagacgttgggcgaggaccctgcgacgtggaacccgaag
catatcgttgtgtacaaggacgggatgaccgcgccgcaggagttgaccccgaagttcagg
atcgagacatactacgaggagctgaggaacgcgaggggggagcgcgggtgcccagagaac
tacccggatggtgcgtggggcgttggcgaggcgctgctctacggggaggtcgtgacgagc
acgcagacgatgctcgacaagaacatccgcctgctcacctccctcccgacgcctctcctg
tccctcgcctccgcacagctgacaggccgcggccgcggggggaacgtctggctttcaccc
ccggggtgcctccagttctcgctgctgctccgcgcgccgctctccgcgctccccgcgacg
aagatcgtcttcgtgcagtacctcttcgcgctcgcagtcgccgaggcgtgccgcacggat
ggtgtgctcggcgaggaggcggggtcgagggtgcgcatcaagtggccgaacgacctgtac
gcgatcacgcccgacggcgagcggaagaagatcggggggatactcgtcaacacgagcttc
ggcgcgggcaaggtcgagctcgtcgtcggtgcgtcctctgccctccgctcccgtcgtctc
acactcacctccacgcccaccttccatcgtgcgtggatgaacatgacgttcacacgttca
tgcgtgcatgctgcctgtccgcagggtgcggcctga

DBGET integrated database retrieval system