KEGG   Dichomitus squalens: DICSQDRAFT_179308
Entry
DICSQDRAFT_179308 CDS       T03133                                 

Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dsq  Dichomitus squalens
Pathway
dsq00100  Steroid biosynthesis
dsq01100  Metabolic pathways
dsq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    DICSQDRAFT_179308
Enzymes [BR:dsq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     DICSQDRAFT_179308
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 18840738
NCBI-ProteinID: XP_007363870
JGI: 179308
Position
Unknown
AA seq 435 aa
MASPSKDATDLNPRTTHYEFLGPPGALAITIGVPAMTYMLYYGCSEETGGCPPPIDVDII
LNSLSTVDFWKGLWDTQAFLAYLAWYAFTVVAWFILPGDWIVGTEIRNGQRKKYKINAFS
TMLLALGLTAGTLYREGPQPFTFIYEHWVGLVTASIAMSVFQGLLVYALSFRKGALLALG
GNSGNPIYDFYIGRELNPSIGSFDLKSFNELRPGLILWMLIDIGMVCEQAMRRGGFNKVT
DSMWLVLAFQSWYVVDALYNEPAIFTTMDITTDGFGFMLAVGDLAWVPFVYSLQARYLVF
NQVELGPIYTAIIIAVNLAGYYIFRVANGEKNDFRNGRNPKNLQYMTTERGTKLLTSGWW
GRSRHPNYMGDLLMAFAWSLPTGFKTPITYFYVIYFAVLLMHRERRDDEACLKKYGKDWT
KYKKLVPWRIIPYVY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcctcgccttctaaggatgcgacggatctcaatccacgcaccacccactacgagttt
ctgggtccgccgggcgcgctcgccatcaccattggtgtccctgctatgacctacatgctc
tactacggctgctccgaagagaccggtggttgccccccgcccatcgacgtcgacatcatc
ctcaactcgctctctaccgttgacttttggaaaggcctctgggacactcaagcattcctc
gcttacctcgcctggtacgctttcactgttgtcgcttggtttatccttccaggagactgg
atcgtgggcactgagatacgcaacgggcagagaaagaagtacaagatcaacgcattctcg
accatgctcctcgctcttggtctcacggccggcactctgtaccgcgagggcccccagccc
ttcaccttcatatatgagcattgggtcggccttgtcactgcgtccattgccatgtcggtc
tttcaaggcctccttgtttatgcgctgtcgttccgtaaaggggctctcctcgcgctcggc
ggaaacagcggcaaccctatttacgacttttacatcggtcgcgagctcaacccatccatc
ggttctttcgacttgaagtcattcaacgaacttcgtcctggtctcatactctggatgctc
attgacatcggcatggtctgcgaacaggccatgcgccgcggaggcttcaacaaggtcacc
gactcgatgtggctagtgcttgcgttccagtcgtggtatgtcgttgatgctctctacaac
gaaccggctatcttcaccaccatggacatcactacggatggttttggcttcatgctcgcc
gttggtgatcttgcctgggtgccgttcgtttattcccttcaggcccgctacttggtcttc
aaccaggttgaactcggacccatctacaccgccattatcatcgctgtgaatctggctggt
tactatatcttccgagtcgcgaacggcgagaagaatgatttccgcaatggtcgcaacccc
aagaaccttcagtacatgaccaccgagcgtggcacgaagcttcttacttcgggctggtgg
ggccgctcacgccacccgaactacatgggtgacctcctcatggcgtttgcttggtctctc
ccgaccggcttcaagacgcccatcacatacttctatgtgatctactttgccgttcttctt
atgcatcgtgagagacgtgacgacgaagcatgcctgaaaaagtatggcaaggactggacg
aagtataagaaactcgttccttggcgtatcatcccctacgtgtactga

DBGET integrated database retrieval system