KEGG   Dichomitus squalens: DICSQDRAFT_77127Help
Entry
DICSQDRAFT_77127  CDS       T03133                                 

Definition
(RefSeq) hypothetical protein
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
dsq  Dichomitus squalens
Pathway
dsq00620  Pyruvate metabolism
dsq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DICSQDRAFT_77127
Enzymes [BR:dsq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     DICSQDRAFT_77127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 18844157
NCBI-ProteinID: XP_007360799
JGI: 77127
Position
Unknown
AA seq 573 aa AA seqDB search
MATATNRVLRVALRGDNILTHPRFNKGTGFTASERKAFGLSGRLPHRINTLEEQYKRAYE
QLRLDEEPLRKNTFLQSLKDQNWVLYYGLLSRHLKELIPIIYTPTQGDAIANYSHLFRRS
EGMYLTFPELDSMEEDFLEQTKDRDLQLFVVTDSEAILGIGDQGVGGIGIATAKSAIYTL
LGGIDPSKTQAVVLDVGTDNEKLLNDPLYVGWPNRRIRGKAYDRFVDKFVQLVRKHYPHS
LLHFEDFGVNNAQRLLDFYRDKHAVFNDDVQGTGAVTLAALMAAVGVTKSKLAEQRIVVY
GAGTAGLGITKQLRDGMGTIDNLSAADANKRFYLLDRFGLVKESLGPEKIRPALHEFVRP
DAEWADVPTNDKGEIGLLEVVKKVRPTVLIGCSTSAGAFTEEIIKEMAKGTDRPIIFPLS
NPTRLVEVTPEQANTWTNGKALMASGSPFPPCKMPNGKMYEIAECNNALIYPGLGFGAMI
TQARKLSDTMIIAGAQKLASLSPAHKDPDNALLPDFAHAREVNTEVAVAVAEQAIAEGEA
GVDWDKEEVRDRIAERQWIAEYPHLVFDPKGER
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcgacgaacagagtcctccgagtcgctctacgcggcgataacatcctcacc
catccgcgcttcaacaaagggacaggcttcacagcctccgaacgcaaagctttcggcctg
agtggccgacttccccaccgtatcaacacacttgaagaacagtacaaacgagcatacgaa
cagcttcgtctcgacgaagaaccacttcgcaagaacacgttcctacaaagcctcaaggac
cagaactgggtcttgtactatggattgctcagcaggcatctcaaggagctcatcccaatc
atttatacgcctacccagggtgatgccatcgcgaactactcccacctcttccgccggagc
gaaggcatgtatctcacgtttccagagctggattcgatggaagaggacttccttgaacag
accaaggatcgcgacctccagctgtttgtcgtaaccgattccgaagcaatccttggtatt
ggcgatcagggcgttggtggcatcggcattgcaactgccaagtctgccatctatacactt
ctaggaggtatcgatccgtctaaaacccaggctgttgtcttggatgtcggcacggacaac
gagaagctgctcaacgaccccctctatgttggttggccgaaccgacgaatccgaggaaag
gcatatgacagattcgttgacaagttcgtgcagctcgtgcgcaagcactacccccacagc
ctattgcactttgaagacttcggcgtgaacaatgcacaacggctgcttgacttctaccgc
gacaagcacgctgtgttcaacgacgatgtgcaaggcacgggcgcagtgactctcgccgcg
ctcatggccgccgtaggcgtcacgaagagcaaacttgccgagcaacgcattgtcgtctac
ggcgccggcactgcagggctcggcatcaccaagcagctccgtgacggcatgggcaccatc
gacaacctctccgccgcggacgccaacaagcgcttctacctcctcgaccgcttcgggctc
gtcaaggagtctctcggtcccgaaaagatccgccccgccctgcacgagttcgtccgcccg
gacgcggagtgggccgacgtgccgacgaacgacaagggcgagattgggctgctcgaggtc
gtgaagaaggtgcggccgacggtgctcatcggctgctcgacgagcgcgggcgcgttcacg
gaggagatcataaaggagatggccaagggcacggacaggccgatcatcttcccgctctcg
aaccccacccgcctggtcgaggtcacgcccgagcaggcaaacacctggacgaacggcaag
gcgctcatggcgagcggcagccccttcccgccatgcaaaatgccgaacgggaagatgtac
gagattgcggaatgcaacaatgcgctcatataccctggccttggcttcggcgcgatgatc
acacaggctcgcaagctctccgacacaatgatcatcgcgggcgcgcagaagctcgcgtcg
ctgtcccccgcgcacaaggaccccgacaacgcccttctaccggacttcgcgcacgcgcgc
gaggtgaacacggaggtggccgtcgctgttgcggaacaggccatcgcagaaggcgaagcg
ggcgtagactgggacaaggaggaggtcagggacagaattgcggagcgccagtggatcgcc
gaatacccgcaccttgtgttcgatcccaagggcgaacggtag

DBGET integrated database retrieval system