KEGG   Drosophila serrata: 110177409Help
Entry
110177409         CDS       T06108                                 

Definition
(RefSeq) soluble guanylate cyclase 89Da
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dsr  Drosophila serrata
Pathway
dsr00230  Purine metabolism
dsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110177409
Enzymes [BR:dsr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110177409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc zf-RING_13
Motif
Other DBs
NCBI-GeneID: 110177409
NCBI-ProteinID: XP_020799786
Position
Unknown
AA seq 668 aa AA seqDB search
MYGMLYESVQHYVQEEYGVDVWKKVCHIIDCKHNSFKTHQIYPDKLMPDIAAALSACTGE
SFDFCMNFFGKCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHLIMRFTYPKMKSPSMQ
LTNMDDDGAVILYRSSRTGMSKYLIGQMTEVAREFYGLGIKAYVIESQNDITGGTAGPIK
LADGPLTVIVKYRLDFDNREYMAKRVNTEAHPSQLRMPTVNLNVFLDLFPFTIVLNHDMK
ITHAGEKIVETWIMHNPGANPKGFIGTHVMDLFHCRRPKDTTIDWATLIQMRAVLFEFEL
IRTGHNRAAYDAVLNMDFENYDEMDLNEAQTMALAKAKEFNDAHPVDKDEASGEDEIDPA
TGERRSSQGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRE
LVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRHSQ
EQVCQSFEEVSVIFLEVLNVYDGGLNSIQGAMQAVNTLNKVFSSLDEEIISPFVYKVETV
GMVYMAVSGAPDVNPLHAEHACDMALRVMKKFKTHDMGEVAIRVGINSGPVVAGVVGQKV
PRYCLFGDTVNTASRMESSSDPWKIQLSTYTAEKVRQVGYKVESRGTVKVKGKGEMETYW
LLEGPPEG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaatgctctacgagagtgtccagcactacgtgcaggaggagtatggcgtagat
gtctggaagaaggtttgccatatcatcgactgcaaacataacagcttcaagacgcaccag
atctatccggacaagctaatgccagacattgccgctgccttatccgcctgcaccggcgag
tccttcgacttctgcatgaacttcttcggaaagtgcttcgtgcgcttcttcagcaacttt
ggctacgacaagatgattcggtccaccgggagatacttttgcgatttcctacaatcaatt
gacaacatccatctcatcatgcgctttacatatccgaagatgaagtcacccagcatgcag
ttgaccaatatggatgacgacggagctgtgatcctctacaggagtagtcgcacaggaatg
tccaagtatcttatcggacagatgacggaggtggccagggagttttacggcttgggtatc
aaggcctacgtgatcgagagtcagaacgacatcaccggaggcacagctgggcctataaag
ctcgctgatggcccccttacggtgattgtcaagtatcgactggacttcgataacagagag
tacatggccaagcgagtcaacacggaggcccatccatcgcagctccggatgcctacagtc
aatctaaacgttttcctagacttgtttcctttcacgattgtgctgaaccacgacatgaag
atcacgcatgccggcgagaaaatagtggagacgtggattatgcacaatcctggcgccaat
cccaaggggttcatcggcacacatgtcatggaccttttccactgccggaggcccaaggat
accaccattgactgggcaactttaatacagatgagggcagtcctctttgagttcgagctt
attcggacaggtcacaaccgtgccgcctacgatgccgtgctgaatatggactttgagaat
tatgacgagatggacttaaacgaggctcagacaatggccctggctaaggctaaagagttc
aacgatgcacatccggtggacaaggatgaagcctcgggagaggatgagattgacccggcc
acgggagagcgacgatcttcccaaggccttcgctcgatccttttgaagggacagatgttc
tacattaaggacgtggactcgctgatctttctctgtagcccgctcatcgagaacctggat
gaactgcacgggattgggttgtacttaaacgaccttaatccgcacggtctgagccgagag
ctcgtcatggctggctggcagcactgctctaagctggagataatgtttgaaaaggaggag
cagcgatcagatgagctggagaagtccctggaactggccgactcttggaagcgtcagggc
gatgagctcctgtactccatgattccccgacccattgcagagcgtatgcgacatagccaa
gagcaggtctgccagagcttcgaggaagtgtctgtcatcttccttgaggtcctcaatgtc
tacgatggaggtctgaatagcatccagggagccatgcaggccgtgaatactctaaacaag
gttttttcctctctggatgaggagatcatttctccgtttgtgtacaaggtggagaccgtt
ggcatggtttacatggctgtttctggtgctccagacgtaaatcctcttcacgccgagcac
gcctgcgatatggccctacgcgtgatgaagaagttcaaaacacatgacatgggcgaagtg
gccattcgggtgggaatcaattctggacccgtggtagcgggagttgtgggccagaaggtg
ccgcgctactgcctcttcggagacaccgttaataccgcctcacggatggagagtagcagc
gatccctggaagatccagctgtccacatacacggccgagaaggtgcgccaggtgggctac
aaggtcgaatcacgcggcacagtcaaggtcaagggcaagggagaaatggaaacgtattgg
ctgctggagggaccaccggagggctaa

DBGET integrated database retrieval system