KEGG   Drosophila serrata: 110178101Help
Entry
110178101         CDS       T06108                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
Organism
dsr  Drosophila serrata
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 NUC130_3NT DOCK_N
Motif
Other DBs
NCBI-GeneID: 110178101
NCBI-ProteinID: XP_020800770
Position
Unknown
AA seq 2072 aa AA seqDB search
MSNAQRSFVQKVSKQSAADVRKNVSNCHLSKTIDTSLCSSTVSPTEPLDYEEFLSQHMNI
ISRDPLKHILDFPQGDVTVKVIPRKIRTVDHIVPSEKLTDLPQHVQECVNCYTRPWKTVE
YAQRHLSSSCYIRERIDRGAISPSAYQQEFEIDKDFASFEETFAYKSESCTPSSRQSIAS
LASVSSCTDTLTPRGSWASFDLRRSVNDPLIPNLLDNVPPEQIDQTNEARRQQDRQVALF
SLYPESELEESIERRLMADIPMEHMGHRIQVKCLQLRLELEVEPIFASMAIYDAKERQKI
SENFYFDMNSDSLKRMLSTHVQCADVSTQSHSAIFEISYPSNDLFLVIRLEKVLQGDINN
SVEPYLKEDKDKYREKVKSNAADYCERLGKYRMPFAWTGIYLTDVFNGDNFEGKDVGGND
RDSAASGAGSSGLGTAPSSNSLDRKSSTSSFDQLRRKADYVSGTLTRRGSLERKEKRRSW
SPDDFANVVENFRPITITVPNFFKQEADKMKDEDLYKILPELKRPSSVMKKYKCIPGSIK
LEISPCIEDAKNSLTPELAKINPQSAENTRPVKEVLEFPHSAIFNPHYTYRNLLFVSPKE
LNFSSRAGSARNIAVRIQLMAGETPKDAVNAIYGKSSCPKFSTEAFTAVNYHNKCPSFYD
EIKIALPASIKQHHHLFFTIYHVSCQKKPQDVQPSVETPIGYTWLPLLEDGKLKVGEFNL
PVMVESPPENYSFIPPNVHLPGIKWLDNHRAVFAINVEAVTAIHTLDAFLDRFFLICEYL
DTRNIPSHIGEGNIEAELKKCLLDIENASREALVRHLPLVLDKLIELLVMTHKIGGQTMS
LGSTVFEVLCLVSSLLSILNDDLVVDQYGRQSLLSTYVQFQCKIPHPFHSKQRLTCSRST
TDELQVSESYSLYDDVITSGRSLDRKDPSMDIIHSIVGRDVQVRLLHEELALHWVVASGK
AAELAMSNSWFLFELIIKSMIEHLHNSNTLNGPRKNRFPHQVNDDLSTLVHLVTTKVVGY
HCSEPKLAQSLNASLGFFIFDILSIMDRGFVFGLIKTYTKVLISKNASIPDLMNYKLDFL
RIVCSHEHFVALNLPFGTSYTMVSAPCSPTPSTTSCNSQTSCGSLERALHADLSREFLQQ
HFLVGLVLSDLAAVMEVPNPQLHGKAIRCVRNLMTSHDLDTRYSDTEARARVAALYIPLL
SIVMDSIPQLHQHGLEQDRLQQIGQLEDYQGPHQTMTTTTINPEVAYAISGSRPYSYMSE
QVKTKSPFSSENTRHLMVCFLWVLKNLERSILYRWLLGLSPHRVHQMLQVVNVGLKTFEY
TGQRHVPTLKRTNTQSFRKNVSTDVKEKLEECIRGTNSARYDLINRRKDRNSTEKFRWRK
DQMPYRSQYADGTGKSEHEIELSHFIEGSLATEVALVLLDTLEIIVHVAANLHHNLLGTV
LKVLLHALSRNQSTLALQNLFASQRALIFKFPNLLFDEETDICADLCLILLKHCGSLLPG
IRSQAAASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSTVFSEQSLRRALKTVLVYA
ESDSDLQDTSFPEQVQDLLFNLHMILSDTVKMKEYQEDPEMLLDLMNRIAKGYQNNPDLR
LTWLENMAKKHRERANHTEAAMCYVHAAALVSEYLSMLESQTHLPVGAVTFQRVSPNTLM
ESAVSDDVLSPGEDGICLGNHFTETGLKALLEEASNSFQVAGMYEAMNEVYKILIPIYEA
NRDFQKLSKVHGKLQEAFNRIAQLQGKRVFGTYFRVGFYGGKFGDLDQQEFIYKEPTLTK
LPEIFSRLQNFYTERFGPDSVHIIKDSNAVDINSLDPDKAYIQITYVEPYFETYEMRHRE
TYFERNFNIKRFIYATPFTKNGKAHGELHEQCKRKTILTTANHFPYVKTRIMVISRQQIV
LEPIEVAIEDIQKKTVELAAATNQEPADPKILQMVLQGCIGTTVNQGPMEMASVFLSNLS
DGTTVPTKHQNKLRLCFREFSKRCADALKKNRNLILSDQKDYQRELERNNDRFIERLTPF
ITLTTAQNNGIVKANANNNKSTPLKCVADYFK
NT seq 6219 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgcacagcgctcgtttgtgcaaaaggtttctaagcagtcggcggcagatgta
cggaaaaatgtttccaattgccatttgtctaagaccatagacacgtcgttgtgctcttct
acggtttccccgacagagccgctcgactatgaggagttcctctcgcagcatatgaacatc
atcagccgagatcccttgaagcacatcctggactttccccaaggagatgtaactgtaaaa
gtcattccccgaaaaatccggactgttgatcacattgtccccagcgaaaaactgacggat
ttgccgcaacatgtccaagagtgcgtcaactgctacacacggccatggaagacagttgag
tacgcgcagcggcacctctccagctcgtgctacattcgcgagcggattgatcgcggtgcc
attagcccgtcggcataccaacaggagtttgagatcgacaaggacttcgcttccttcgag
gagacgtttgcctacaagagcgaaagctgcactcccagttcaagacagtctatagcgagt
ttagcttcggttagttcttgcacggataccttaacgcctcgcggctcgtgggccagcttc
gatctgcggcgctcggtcaatgatcccctcataccgaacctactggacaacgttccgccg
gaacaaatcgatcagaccaacgaagcgcgacggcagcaggaccgtcaagtggctctcttt
tcgctgtatccagagtctgaattggaagaaagcatcgagcggaggttgatggccgatatt
cccatggagcacatgggacaccgcattcaagtcaagtgccttcagctccgtcttgaactc
gaggtggagccaatctttgcctctatggcaatatatgacgccaaagaacgtcagaaaata
tcggagaacttttacttcgacatgaattcggatagtctgaagcggatgttgtcaactcac
gtccagtgtgccgacgtcagcacccagagccactcggccatatttgaaatctcatacccg
agcaacgaccttttcctcgtaattcgtctggagaaggtgttgcagggcgatattaacaac
tcggtggaaccgtacttgaaggaggacaaggataagtaccgagagaaggtgaagtcgaac
gccgccgactattgtgagcgtttgggaaaatatcgaatgccttttgcatggaccggaatc
tacttgacggacgttttcaatggcgacaattttgaaggcaaggacgtcggggggaatgac
cgcgattccgctgccagcggggccggcagcagcggattgggcacagctccgagctctaat
agtttggatcggaagtcatcaacaagtagctttgaccagctcagacgaaaagccgattat
gtgagcggaaccttgactcgccgcggctctttggagcggaaggagaagcggcgatcgtgg
tcgccagatgatttcgcgaatgttgttgaaaactttcgccctattacgataacggttcca
aacttcttcaagcaagaggcagataagatgaaggacgaggacttgtataaaattctgcca
gagctaaaacgaccaagctcagttatgaagaaatacaaatgcattccaggctccattaaa
ctggagatctcaccctgcattgaggacgccaagaactccctaacgccagagctggccaaa
ataaacccgcagagcgccgagaacacacgccctgttaaagaagtgctggaatttccacac
tcggctatttttaatccacactacacctatcgcaatctgctgttcgtttcgccaaaagaa
ctcaatttctcatcgcgtgctggttccgcacgtaatattgccgtacgcatacagttgatg
gcgggcgaaacaccaaaggatgcagtaaatgccatttacggcaagtcttcttgcccgaaa
ttctcaacagaggcattcacggctgtcaactaccacaacaagtgcccatcgttctatgat
gagataaaaattgccctgcctgcctcaataaagcagcatcatcacttatttttcaccatc
taccatgtgtcctgtcaaaagaagcctcaggacgttcaaccgtcggtggagacacctatt
ggttatacatggctgccattattggaggatggcaagctcaaggttggagaattcaatctg
cctgttatggtggaatcaccaccggaaaactactcctttatacctccaaatgtgcatctc
cccggtatcaaatggctggacaatcacagagcagtgttcgctatcaatgtagaagcagtg
actgccattcatacgttggatgcttttctggatcgtttctttctgatctgcgagtatctg
gacactcgtaatataccgtcccatatcggtgagggaaatatagaggcggaactcaagaag
tgtttactagacatcgagaatgcaagtcgggaggcgttggtgaggcatttgccattggtc
ctggataaacttatcgaattgctggtgatgacccacaagattggtggccaaaccatgtct
ctgggctctacggtcttcgaagttctgtgcttggtttcgtcactcttgtccatattaaac
gacgatctcgtagttgaccaatacggacggcagagtttgctttcgacttacgtgcaattt
cagtgtaaaattccccatcccttccacagcaagcagagattaacgtgtagtcgcagcaca
acagatgagctgcaagtgagcgagtcctatagcctgtatgatgatgtgataactagtggt
cgcagtctagaccgaaaagacccttcaatggatattattcactcaatcgtgggtcgggat
gttcaagtgcgcctgctacacgaagaactggccctccactgggtcgttgccagtgggaaa
gcggccgagttagccatgtcgaattcatggtttttatttgagctcatcatcaagtcaatg
attgagcacttgcacaactccaacaccctgaatgggccgcgtaagaatcgtttcccacac
caggtcaatgacgatttgtctaccctggtgcatctagtcactacaaaagtagttggctac
cattgcagcgagcccaagttggcacaatccctgaatgccagcttaggcttttttattttc
gacatcctgagcattatggaccggggatttgtatttggcttgattaagacctacacgaag
gttctgatttctaaaaacgcctccataccagatttaatgaactacaaattagacttcttg
agaattgtgtgtagccatgaacactttgtagctcttaacttgccgtttggaacttcgtac
acgatggtttctgcgccatgtagccccactccaagcaccacatcgtgcaacagtcagacc
tcatgcggatcattagaacgagctctacacgcggacctcagtcgggaattcctccaacaa
cactttctagtcggacttgttctcagcgacttggctgcagtaatggaggttccgaatccc
cagttacacggaaaggctattcgctgcgttcgtaacctaatgacatcgcacgatttggac
actcggtacagcgataccgaagcccgtgccagagtggcggctttgtacatccccctgctc
tcaatagtcatggacagcattccgcagttgcatcagcatggacttgaacaggaccgcttg
cagcagatcggacagctcgaagattaccaaggcccccatcaaaccatgacgacaaccacc
ataaatccagaagtggcatatgcaatatccggcagtcgtccctactcctatatgagtgag
caagtcaagaccaagtctccattcagttcagaaaacacccggcacttaatggtctgcttt
ctttgggtgttaaagaacttggagcgaagtattctttaccgttggctgttgggcctgagc
ccgcatagagtgcaccaaatgctgcaggttgtaaacgttggcctcaaaacgttcgaatat
acggggcagagacacgtccccaccctaaagcggacaaatactcaaagctttaggaaaaat
gtgtctacagacgtgaaggagaagttggaggaatgtataagaggcaccaactctgcacgc
tacgatctaataaacaggcggaaagatcgcaattcgacagagaagttccgctggcgaaag
gatcagatgccctaccgctcacagtatgcggacggcacgggcaaaagtgagcatgaaatt
gaattgagtcacttcattgaaggttctctggctaccgaagtagcacttgtactcctggac
acccttgaaattattgttcacgtggccgctaacctccaccacaatctcctggggaccgtg
ctcaaggtgttgctgcatgccctgtcccgaaatcaatcaactctagcgctacaaaacttg
ttcgcctcgcagcgcgctctaatcttcaaatttccgaacctactatttgatgaggagacc
gacatatgtgccgacttgtgtttgattttactgaagcactgcgggtctcttttgcctggt
attcgctcacaagcagctgcatccctttatctcctgatgagacaaaacttcgaaatcggc
aataatttcgcccgcgtcaagatgcaagtgactatgtcgttaagttcgcttgttggtacc
agcacggtgttcagtgaacagtctttgcggcgcgcgctgaaaacagttcttgtgtatgcc
gagtcagactctgatctccaggacacgtcgttcccagagcaagtgcaggacctgttattc
aatctccacatgatactgtctgatactgtgaagatgaaggagtaccaagaagatccagaa
atgttgcttgatctcatgaatcgtattgcaaagggttaccagaataatcctgatctaagg
ttgacttggttggagaatatggccaagaagcaccgtgagcgtgcgaaccatactgaggca
gcaatgtgctatgtgcacgcagctgctttagtttctgaatatcttagcatgctggagtca
cagacccaccttcctgttggcgccgtcacttttcagcgcgtttcaccgaacactcttatg
gagtcagcggtgtcagatgacgtcctcagtccaggggaggacggcatctgcctgggaaac
cactttacggaaactggactgaaggctttgctggaagaagcctccaattcgtttcaagtt
gctggcatgtatgaagcgatgaacgaggtgtacaagattctgattcccatttacgaagcg
aacagggattttcagaaactcagcaaagtgcacggcaagctgcaggaagctttcaacaga
atagcccagctacagggaaaaagggttttcggcacatactttcgtgtgggtttttatgga
ggcaaattcggagatctggaccagcaggaatttatttacaaagaacccactttaacaaag
ttaccagagattttcagccgcctccagaacttctacaccgaacgcttcggaccggactca
gttcatatcatcaaggactcaaatgcagtcgacataaactctttggatcccgataaggcg
tacattcagataacctatgtggagccatactttgaaacctacgagatgcgtcatcgagaa
acatattttgagaggaatttcaatatcaaacgtttcatatatgcgacgccgttcacgaaa
aacggaaaagcacacggcgaactccatgagcagtgcaagcggaagacgattctgaccaca
gccaaccactttccgtacgtgaaaactagaataatggttattagccggcagcaaatagtc
ttggaacccattgaagtggcaatagaggatatccaaaagaaaacagtggagttggcggcg
gctacgaatcaagagcctgcggacccaaaaatattgcaaatggtgctgcaggggtgcata
ggaaccaccgtgaatcaaggacccatggaaatggcaagcgtgtttctctcaaacctatcc
gacggcaccaccgtgccaaccaagcaccaaaacaagctgcggctctgcttccgagagttt
tcgaagcgttgtgcagatgccttgaagaagaatcgcaacctaatactttccgatcagaaa
gattaccagcgggaactggagcgcaacaacgatcgtttcattgagcgcttgacgcctttt
atcactctgacaacagctcagaacaatggcatcgttaaggctaatgcaaacaataacaaa
agcactccgctgaaatgcgtggcggattattttaagtaa

DBGET integrated database retrieval system