KEGG   Drosophila serrata: 110179328Help
Entry
110179328         CDS       T06108                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
dsr  Drosophila serrata
Pathway
dsr00900  Terpenoid backbone biosynthesis
dsr01100  Metabolic pathways
Module
dsr_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110179328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dsr01006]
    110179328
Enzymes [BR:dsr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     110179328
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     110179328
Prenyltransferases [BR:dsr01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   110179328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt AsiA
Motif
Other DBs
NCBI-GeneID: 110179328
NCBI-ProteinID: XP_020802479
Position
Unknown
AA seq 416 aa AA seqDB search
MFKLVRQLLPQQRILANAVGLPRVISTSNEVNSEPIIKSVGGLPTELVTEQKLKKTSRTL
STLQNHSVPIAARVTVSKDESRDFMAVFPDLVRDITTVTKTYNCNDAAKWFAQVLQYNVP
RGKKNRGILTVLTYKNLVPAQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRG
QPCWHKVENVGLTAINDALMIENAMYAILKMHFSHLDCYVALMELFHEITYITTCGQSLD
QLNSNRSVSEFTMENYKAIVENKTAYYSFYLPFAIALHLAGYKDAEAFRQSKTILLEMGN
FFQVQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANAEQKQIMIDCYGKEDPAK
VNRVKELYKELGLPSTYATFEEESYNMIKTHIQQTSRGVPHQTFLQILNKIYQRDS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattggtccgccagcttctgccgcagcagcggatccttgccaacgccgtgggc
ctgcctcgggttatctctaccagcaacgaagtcaactcagagcccattatcaagtcggtt
ggcggcttgcccactgaactggtcaccgagcagaagctgaagaagacgagcagaacctta
tcgacgctccaaaatcactccgttcccattgcggcccgcgtcacggtgtcgaaagatgaa
agccgcgactttatggccgtgttcccagatcttgtgcgtgacatcaccaccgtgacaaag
acgtacaactgcaatgatgctgccaagtggttcgcccaggtccttcaatacaatgtgccc
aggggcaagaagaaccgtggcatccttaccgttttgacttacaagaatctggtgccggca
caggatctcactccggagaacataaagctggcccagtacctgggctggtgcgtggaaatg
ctccagagcttcttcattatctcggacgatgtgatggacaacagcactaccagaagaggc
cagccgtgctggcacaaggtcgagaacgttgggctgaccgccatcaatgatgccctaatg
atcgagaatgccatgtatgccatactgaagatgcacttcagccacttggattgttatgtg
gccctgatggagctcttccatgaaatcacctacatcaccacttgcggccagtcgctggat
cagctcaactcgaatcgcagtgtctcggagttcacaatggaaaactacaaggcgattgtg
gaaaacaagactgcctactattccttttacctgcccttcgcaattgctttacacttggct
ggatacaaagacgccgaggctttccggcagtcaaagaccattctcctggaaatgggcaac
ttcttccaggtacaggacgacttcctcgattgtttcggcaatccggaagtgacgggcaag
attgggacagacattcaggacaacaagtgctcttggctggctgtggtggctatgcaacga
gccaatgccgagcagaaacagatcatgatcgattgctatggcaaggaagatcccgccaag
gtaaacagagtcaaggagctgtacaaggagctcggactgccatctacttatgccacgttt
gaggaggaatcttacaacatgatcaaaacccacatacaacaaacctcccgcggggtgccg
caccagaccttcctgcaaatcctcaacaaaatctaccaacgtgactcctag

DBGET integrated database retrieval system