KEGG   Drosophila serrata: 110179408Help
Entry
110179408         CDS       T06108                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 1
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
dsr  Drosophila serrata
Pathway
dsr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110179408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dsr03041]
    110179408
   03110 Chaperones and folding catalysts [BR:dsr03110]
    110179408
Enzymes [BR:dsr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110179408
Spliceosome [BR:dsr03041]
 Complex B
  Other components
   Prp19-related factors
    110179408
 Complex C
    110179408
Chaperones and folding catalysts [BR:dsr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    110179408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110179408
NCBI-ProteinID: XP_020802593
Position
Unknown
AA seq 176 aa AA seqDB search
MLSLTDAGNSVGIPDKAWQPHFVTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNV
VFHRIIRDFMIQGGDPTGTGRGGASIYGAEFGDELHGDLKHTGAGILSMANSGPDTNGSQ
FFITLSPTQWLDGKHTIFGRVYTGMEVVKRIGMVETDKNDRPVDPLRIIKAKVEKL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctctaactgatgccggtaactctgttggcattccagacaaggcctggcagcca
cactttgtgactctggaaacgagcatgggtgaaatcacagtggagttgtactggaaacat
gcgcctaacacatgccggaactttgccgagctgtcccgaagaggctattacaacaacgtg
gtgttccatcgcatcatcagggacttcatgatacagggaggtgatcccaccggcacgggc
aggggcggtgcctccatctacggcgcggagtttggcgacgagctgcacggcgacctgaag
cacacaggcgccggcatcctttccatggcaaactcggggccagacaccaacggctcccag
ttcttcatcactctgtcgcccacgcaatggctggacgggaagcacacgatcttcgggcga
gtgtacaccggcatggaggtggtcaagcggataggaatggtggagacggacaagaacgat
cgtcccgtggatccgttgaggatcattaaggcgaaggtggagaagctgtga

DBGET integrated database retrieval system