KEGG   Drosophila serrata: 110180442Help
Entry
110180442         CDS       T06108                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 1-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
dsr  Drosophila serrata
Pathway
dsr00430  Taurine and hypotaurine metabolism
dsr00480  Glutathione metabolism
dsr00590  Arachidonic acid metabolism
dsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110180442
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    110180442
   00480 Glutathione metabolism
    110180442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dsr01002]
    110180442
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dsr04090]
    110180442
Enzymes [BR:dsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     110180442
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     110180442
    3.4.19.14  leukotriene-C4 hydrolase
     110180442
Peptidases and inhibitors [BR:dsr01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   110180442
CD molecules [BR:dsr04090]
 Proteins
  110180442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 110180442
NCBI-ProteinID: XP_020803771
Position
Unknown
AA seq 554 aa AA seqDB search
MCFLILAVAAVGVTSQEEPRRMGAVVSNGIGCAEVGGNILDIGGSAADAVIATMLCEEVV
VPHALGIGGGFVATIYTKETGSMESLIARETAPAAAKQDMFMGREEVFTGAIDSGVPGQI
YGLAKLHEKYGRLPWKSLFQPAINLCRQGIEVSENLSAALVKRKKYIWSRASLAEIFINP
KTDNMYRKGEIMYRHRLANTLEILAEEGAQAIYGGGSLGRKLVEDIQEMGGIITEEDLKR
YNVRWERPLHSRFHGYELYTSPLPTSGAVLIFILNVMEPLFTNNTDIYWHRLIETFKHAY
GRRSNLADIHYEPDVQEMYENLINPAFAAEIRRLIRDNTTFEDLTYYGANFTNVEDHGTA
HISVLAPNGDAISVTSSINADFGAKVRSRQTGIILNGQMDDFSTPGKINYYNLPPNPFNY
IKPGKRPLSSMCPSIVLDSHGNVKLIVGGAGGATITTTVSQTILKYLVLHESIEDAVNGP
LLHHQLVPMIISTEHELNNHTIAHLEAMGHRVKFQLLQHSAQTAIGVTDGKPEPVCDQRR
YGSVVVVKQPKLIE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgctttcttatcttggcagtagctgcagttggcgtgaccagccaggaggagccccgt
cggatgggtgccgtggtctccaacggcataggctgtgccgaggtgggtggcaacatcctg
gatatcggaggatccgcagcggatgccgtcattgccaccatgctttgtgaggaagtagtg
gtacctcatgctctgggcattggtggcggctttgtggccacaatttacaccaaggaaacg
ggctctatggagtctctaattgcccgtgaaacagccccggcggctgccaagcaggatatg
ttcatgggacgggaggaggtgttcacgggagccattgatagtggagttcctggtcagatc
tatggtttggccaaactacatgaaaagtatggtcggctaccctggaagagtctattccag
cccgcaatcaatctttgccggcagggtattgaggtttccgaaaatctgtccgctgccctt
gtaaagcgtaagaaatacatctggagtagggcctcactggccgagatcttcattaatccc
aagacggataatatgtataggaaaggtgagatcatgtaccgtcacaggctggccaacaca
ctggagatcttggccgaggaaggcgctcaggctatttacggaggcggcagcttaggacga
aagctggtcgaggacatccaggaaatgggcggcatcatcaccgaggaggatctgaaaaga
tacaatgttcgctgggaacgccctctgcacagtcgctttcacggctacgagctatacaca
tctccattgcccaccagtggcgctgtgctcatcttcatcctgaacgtaatggagccgctg
tttacaaacaacacggacatctactggcaccgactgatcgagacctttaagcatgcctat
ggtcgtcggtccaatttggccgacatacactacgaaccagatgtgcaggagatgtacgag
aacctcattaatccggcctttgcagctgagatccgtaggctgatccgggacaacaccacc
tttgaggacttgacctattatggggcaaatttcaccaatgttgaggatcatgggacggcg
cacatctccgtgctggcacccaatggagacgccatttcggtcaccagctccataaacgct
gattttggagccaaggtgcgatcccgccagacgggtatcattctcaacggccagatggat
gacttcagcacgccgggaaagataaactactataacttaccacccaaccccttcaactac
atcaagcccggtaagagacccctctcctccatgtgtcccagcatcgtgttggactcgcac
ggcaatgtaaagctgattgtgggtggtgccggtggtgccacaatcaccaccacggtgtcc
caaacaattctcaagtatttggtcctgcacgaatccatcgaagatgctgtaaatgggcct
ctattacatcaccaactggtgccaatgataatcagtacggagcatgagctgaacaaccat
acaatcgcccatctagaggccatgggtcaccgtgtgaagtttcaactattgcagcactct
gcccagacggccatcggagttacggacggaaagccagagccagtctgtgatcaaaggaga
tacgggagtgttgtggtcgtaaagcaaccaaagctcatagaatga

DBGET integrated database retrieval system