KEGG   Drosophila serrata: 110181645Help
Entry
110181645         CDS       T06108                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
dsr  Drosophila serrata
Pathway
dsr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    110181645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dsr03011]
    110181645
Ribosome [BR:dsr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    110181645
  Bacteria
    110181645
  Archaea
    110181645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 Lipase_C
Motif
Other DBs
NCBI-GeneID: 110181645
NCBI-ProteinID: XP_020805118
Position
Unknown
AA seq 232 aa AA seqDB search
MHKVIRQMTQLRLQPLQGAALLKTGDTPAPMLSQLSSPPAFNQKSIHTGAAGGILCAKWN
KHNYGPRKWLEYNKTVHPPQETDEEPRKAYVCHMRSNIKYSPDKMWYIAAFVRGMSVDEA
LKQLNFVLKKGATDVKETILEAQEMAVQRHNVEYKSNLWIAESFVGKGRVFKGMRRHARG
RFGHVEYKHCHYFVRLEEGEPPKHYYQEPQTPEQQYEHWLEQMRSRKIINSL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggtgatccggcagatgacgcagctgcgtttgcagccgctgcaaggagcggcg
ctgctcaaaacaggagataccccagcgcctatgctaagccagctatcgtcgccacctgct
ttcaatcagaaatctattcacacgggagctgcgggcggaattctgtgtgccaaatggaac
aaacacaattacgggccgcgaaagtggctggaatacaacaaaacagtgcatccgccgcag
gaaacagacgaggagccacgcaaagcttacgtctgccatatgcgctccaatattaaatac
agtccggacaaaatgtggtacatcgcagccttcgtccggggtatgtccgttgatgaagcc
ttgaagcaactgaattttgtgctcaaaaagggggcgaccgacgtaaaggagactatactg
gaggcccaggaaatggctgtgcagcgtcacaatgttgaatacaaaagcaatctgtggata
gccgagtcctttgtgggcaagggacgcgtctttaagggtatgcggcgacatgcccgtggt
cggtttggtcacgtggagtacaagcactgtcactactttgtgagactggaggagggcgag
ccgccaaagcactactaccaagagccacagacaccggagcagcaatacgaacactggctg
gagcaaatgcgcagtcggaagatcatcaactcgctttag

DBGET integrated database retrieval system