KEGG   Drosophila serrata: 110184085Help
Entry
110184085         CDS       T06108                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dsr  Drosophila serrata
Pathway
dsr00450  Selenocompound metabolism
dsr00970  Aminoacyl-tRNA biosynthesis
dsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110184085
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110184085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dsr01007]
    110184085
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dsr03016]
    110184085
Enzymes [BR:dsr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110184085
Amino acid related enzymes [BR:dsr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110184085
Transfer RNA biogenesis [BR:dsr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110184085
 Prokaryotic type
   Other AARSs
    110184085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 GST_C_3 tRNA-synt_1 GST_C_2 GST_C Anticodon_1 GST_C_6
Motif
Other DBs
NCBI-GeneID: 110184085
NCBI-ProteinID: XP_020808130
Position
Unknown
AA seq 1010 aa AA seqDB search
MIIYTNEGNPLGLQLLMLVKHAKREVQVQLVNLNDPNYKDLLVLPTLQLDNGLSLFSPAA
IAKYLLVDEGQLRDEWLEWSATLLAPALAHHMAVGHKADANALPVLNALVKKLDDSLKTS
PFLAGDKLTAADIAVWSLLAPEGTLKGAQNVDRLRDWYGRIKVLPEVQEVLAEQPLKDLS
FNALQQSNRYGGLYHIPLKRLSVADAGKLLVDTTPTVADTVTDDEIRAAQAAFTYTAPKD
IKEERTVLPKAGQRNVLITSALPYVNNVPHLGNIIGCVLSADIFARYSRSAGYNTLLICG
TDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAF
QDVLKAGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNAT
ELIRPRCKVCNSAPVLRSSDQLFIDLPKAEPNLKEWVDKSEGGWTHNAKVITRAWLKEGL
KPRCITRDLKWGIPVPHAGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVEL
FQFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQ
ETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFNST
VPEVVATQDELILLALINRELRGYINSLEKAKLRDGIRHLLAISRHGNGYMQTQQPWVLL
KGSEDQKKRAATIIGLCANIACLLANLLFPYMPATARTLFSQLNAKQTALNADKPLATLL
LPAGHKIGKPAPLFAKLEQSFIDELKTKYGGAQTAAVHSQGSAAELEKAVQDQADKVRQL
KASTKDKTVWQPEVNKLLDLKKQLEEAKKAAPVATLAPANGSQSVQDLEKAIQEQGDKVR
KLKGSTKDKSVWQPEVNILLDLKKQLDAAQKAAKAAPSTVAATTSSVDAAQVKALEDKIA
QQGEKVRTLKAAGNADVWKPEVATLLALKNELSALTGAPAAGGQAKGKKK
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgatcatctatacgaacgagggcaatccgctgggactgcagctactgatgctggtcaag
cacgccaagcgggaggtgcaggtgcagctggttaacctaaatgatcccaactacaaggat
ctcttggtgctgcccactctgcagctggacaacggtctgtccctgttttcgccggcggcc
attgccaaatatctgctagtggacgagggacagctgcgggatgagtggctggagtggtct
gccacgttgctggctccggctctggcccatcacatggccgtgggccataaggccgacgct
aatgcgctgcccgtgcttaacgctttggtaaagaaactggacgacagcctcaagacctcg
cccttcctggctggcgacaaactaaccgccgccgacattgccgtgtggtccctcttggca
cctgaaggcaccctaaaaggagcccagaacgtggatcgtctaagagattggtatggacgt
ataaaagttcttcccgaggtgcaggaggtgctggccgagcagccgctgaaagaccttagc
ttcaatgcgttgcagcagtccaatcgctacggcggcttgtaccatattcctctcaaacgt
cttagcgtggcagatgcgggcaaactccttgtggatactacgcccacggtggcggacaca
gtgactgatgacgagatcagagcagcacaggctgccttcacctacacagctcccaaggat
attaaggaggagcgcacagtgctacccaaggctggccagcgtaacgtgctcatcacatct
gctctgccgtacgtcaacaatgtgccccatctgggtaacatcattggttgtgttctgtcc
gcggatatctttgcgcgctactcccgttccgctggctataatactctcctgatttgcggc
accgatgagtacggcacggccacggagaacaaggctttggccgagaatctgacgccgcgt
gaaatctgcgacaagtactttgagctgcacaatgccatctaccgctggttcggcattggc
tttgattactttggacgaactacgacacaggagcaaacagacattgtgcaggaggctttc
caggatgtcctcaaggccggctacatcatcacagagagcgtggagcagctgctctgccaa
aagtgcgatcgcttcctggctgatcgctttgtggagggcacttgcccgcatcctggctgc
ggctacgaggatgcccgcggcgaccagtgcgacaagtgcggcaagctagtgaatgccacc
gagctgatccgtccccgttgtaaggtgtgcaacagtgcgcccgtcctccgttcctccgat
cagttattcatcgatctgccgaaggcagagccaaatctcaaggaatgggtggacaaatcc
gagggcggctggacacacaatgccaaggtgatcacgcgagcctggctaaaggagggcctg
aagccccgctgcattacccgcgacctgaagtggggaatccctgtgccgcacgctggcttc
gaaaagaaggtcttctatgtgtggttcgacgctcccttcggctatgtctcgatgaccaag
cgctacaccaaggagtaccagcagtggtggcagcccgctaaaggcaccgatgtggagcta
ttccagttcatggccaaggacaacgtgcccttccactcggtggtgtggcccagtgtcctg
ctggctatcaacaagggacacacgctcgtctcgcacatcatggccaccgagtatctgaat
tatgaggatggcaagttcagcaagagtcgcggcatcggcgtttttggcaacgatgcccag
gagacgggcattcccgcggacgtttggcgcttctacttggcgtcggcccgtccagagggt
caggattccagcttcagttggaacgatctggcggcgcgcaacaactcggagctgctaaat
aacctcggaaactttgtgaaccgcgccctggtcttctgcgaaaagaacttcaatagcacg
gttccagaagtggtggccacccaggatgaactgatcctgctggccttgatcaaccgcgag
ctgcgtggttatattaactccctggagaaggcgaagctccgcgatggcatccgtcatctg
ctggccatttcccgacatggcaacggctacatgcagacccagcagccatgggtgctgctt
aagggcagcgaggaccaaaagaagcgggcagctactatcattggtctgtgtgccaacatc
gcttgcctgctggccaatctcctcttcccctacatgcctgccacggccaggactctgttc
agccagctcaatgccaagcaaacggcgctcaatgctgacaaacctcttgccactctgctg
cttcccgccggtcacaagattggcaagcccgctccgttattcgccaagctagagcagtcc
tttatcgacgagctcaagaccaagtacggcggagcacagactgctgccgtgcacagtcaa
ggcagtgcagcggagctggagaaagccgtgcaggatcaggcggataaggtgcgtcagctg
aaggccagcacgaaggacaagacggtgtggcaaccggaagtgaataagctgctggaccta
aaaaaacagctagaggaagctaagaaggcagctcccgttgccactcttgctcccgcgaat
ggctcccagtcagtgcaggacctagagaaggctattcaagagcagggcgacaaagtgcgg
aagctgaagggcagcacaaaagacaagtccgtttggcagccggaggtgaatatcctactc
gacctcaagaagcaactggatgcggctcagaaggcggccaaggcagctccttccactgtg
gctgctaccacttcctcggtggatgctgcccaggtcaaagcattggaagacaaaatcgcc
cagcagggcgaaaaagtgaggacattgaaggctgccggcaatgccgacgtgtggaaaccc
gaagtggctacactcttggccctgaagaacgagctgtcggcactgactggagcacccgct
gccggtggccaggcaaagggcaagaaaaagtaa

DBGET integrated database retrieval system