KEGG   Drosophila serrata: 110184652Help
Entry
110184652         CDS       T06108                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dsr  Drosophila serrata
Pathway
dsr00260  Glycine, serine and threonine metabolism
dsr01100  Metabolic pathways
dsr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110184652
Enzymes [BR:dsr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110184652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 110184652
NCBI-ProteinID: XP_020808915
Position
Unknown
AA seq 385 aa AA seqDB search
MAPTKVTVVDLRSDTISKPTDQMRTRMASAEVGDDVYGEDPTVNELESRTAAMFGKEAGL
FVPSGTMGNLLAIMVHCHRRGTEALVGDLSHIFLYEQGGASHLAGVQLATLKNEQDGTFS
LEELRRRIRHDDCHEPITSLVVVENTHNICGGKVVPLSFLDELAALVRQPGVGTGSARIA
LHMDGARVFNAAASLGVGVERICRDFDSVSICLSKGLSAPVGSVLVGGKDFIAEARRLRK
ALGGGMRQVGILAAAGLVALEEVVPLLGKDHERTKKIAKAIYALQSPNITVDLDTVQSNI
LLVEITQPKLKASEFSTRLGTVEPEELEAGLTDASGAGIVVKASARDWAFARLVLYHQVD
DQQVELAIRKLEYVIGQYDKRWPKA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaccaaagtcaccgttgttgacctccgctcggacaccatcagcaagcccacg
gaccagatgcggacccggatggcctccgccgaggttggggatgatgtttatggcgaggat
cccacagtgaacgaactggagtcgcggacagcagccatgtttggcaaggaggcgggcctc
tttgtgcccagcggcaccatgggaaatctactggcaattatggttcattgccatcgtcgc
ggcacggaggccctggtcggcgatttatcgcacatctttctgtacgaacaaggtggcgcc
tcgcacctggccggcgtccaattagccacgctgaagaacgagcaggacggtaccttcagc
ctggaggagctgcgccgccggatccggcacgatgactgccatgagcccatcacctcgctg
gtggtggtggagaatacccacaacatttgcggcggcaaggtggtgcctctctccttcctg
gacgagctggcggctctggtacgccagccgggagtgggcactggttccgcccgcattgcc
ctgcacatggacggagctcgggtcttcaatgcggccgcctccttgggcgtgggtgtggag
cgtatctgtcgcgatttcgattccgtgtccatttgcctcagcaagggcttatcggcccca
gtgggctcggtgctagtgggcggcaaggactttattgcagaagcccgacgactgcgtaag
gccttgggcggcggcatgcggcaggtgggcattctggctgccgccggattggtggctctg
gaggaggtggtgccgctgctgggcaaggatcacgagaggaccaagaaaattgccaaagct
atttatgccctgcagagtcccaacatcactgtggatttggacacggtgcagagtaacatt
cttctggtggagatcactcagcccaagctgaaggccagtgagttctccactcgcttgggt
accgtggaacccgaagagctagaggctggtctaacagacgccagtggagctggaattgtg
gtgaaggccagtgcccgggactgggcctttgcccgtctggtgctctaccaccaggtggat
gaccagcaggtggagctggccatccggaagctggagtatgtcattgggcagtatgacaaa
cgctggccgaaggcatag

DBGET integrated database retrieval system