KEGG   Drosophila serrata: 110186261Help
Entry
110186261         CDS       T06108                                 

Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
dsr  Drosophila serrata
Pathway
dsr00230  Purine metabolism
dsr00240  Pyrimidine metabolism
dsr00983  Drug metabolism - other enzymes
dsr01100  Metabolic pathways
Module
dsr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
dsr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
dsr_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110186261
   00240 Pyrimidine metabolism
    110186261
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110186261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsr04131]
    110186261
Enzymes [BR:dsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     110186261
Membrane trafficking [BR:dsr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110186261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 110186261
NCBI-ProteinID: XP_020811027
Position
Unknown
AA seq 172 aa AA seqDB search
MKLQMLGSILALFSIISVAMAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKF
TWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSL
PGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAVDWVYE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcaaatgctgggctccattttggcacttttctcaattatctccgtagcgatg
gcggccaacaaggagcgtactttcatcatggtcaagcccgatggcgtccagcgtggactc
gtcggcaagatcatcgagcgcttcgagcagaagggcttcaagctggtcgccctgaagttc
acctgggcctccaaggagctgctggagaagcactacgccgacctgtcggcccgccccttc
ttccccggactcgtcaactacatgaactccggccccgtggtgcccatggtctgggagggc
ctcaatgtggtcaagaccggtcgccagatgctcggcgccaccaaccccgccgactcgctg
ccaggcaccatccgtggcgatttctgcatccaggtcggacgcaacatcatccacggctcc
gatgccgtcgagtccgccgagaaggagatcgctctgtggttcaatgagaaggagctggtc
acctggaccccggctgccgtcgattgggtctacgaataa

DBGET integrated database retrieval system