KEGG   Drosophila serrata: 110186477Help
Entry
110186477         CDS       T06108                                 

Definition
(RefSeq) head-specific guanylate cyclase
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
dsr  Drosophila serrata
Pathway
dsr00230  Purine metabolism
dsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110186477
Enzymes [BR:dsr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110186477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 110186477
NCBI-ProteinID: XP_020811323
Position
Unknown
AA seq 676 aa AA seqDB search
MACPFFRRADSLTRQPSVIAEPGAHWALEDEELSDDALTLTHLQMAIQLLTAPSNEDLNT
AVTSLIAKYRQNWPNIHKLKLDPQTFKSCANYDYLADIQELLLKMDEASASEILVLLGEE
LITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCAGEGELIFTSE
RPVIAWLLLGSLKALTRMLYKVDVNIKIEPVEGDARRYRYLFSLVKDNAQTMLMGRPTLV
SKTIPETVQRSNSSNASDLQMNSSSFCKMFPWHFIMNEQLELVQLGRGFSKLYKPYLADF
GCQASTYFDFKRPKGLTMKFRDIVRRTYTPFLIGLMSPPGVSDFPAIGLEIKGQMVHCPE
SNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKLKSS
IEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICS
RATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALK
MIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALK
INVSPTTKEWLTKHEGFDFDLQPRDSAFLPKEFPNPGGTETCYFLEGYRNPALDSQLPLV
EHINAAMKTISEGGDA
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtcccttcttccggcgagcggactcgctaacacgccagccctcggttatcgcc
gagcctggcgcccattgggccctggaggatgaggagctctcggacgacgctctgaccctc
acgcacctgcaaatggccatccagctgctgacggcgccgtcgaacgaggatctcaacacg
gccgtcacctccctgatagccaagtatcgccagaactggcccaacatacacaagctaaaa
ctggaccctcagaccttcaagagctgtgccaactatgattacttggccgacatccaggag
ctgctcctcaagatggacgaggcaagtgccagcgagattctggtgcttctcggggaggag
cttataacctgctgctgcacgggaatcattgagcgggccttccgctgcctgggcacggat
ctgcaggagttcctgggctccctggatggggtctacgatgtgctcaagttgcaggaggag
gatgtgaccgacactggcttcgtgtgcgccggcgagggtgagctgatcttcacctctgag
cgtccggtgatcgcatggctgctcctgggctccctgaaggccctcacccggatgctgtac
aaggtggatgtgaacatcaagatcgagcccgtggagggcgatgcccggcgctatcgctac
ctgttctcgcttgtcaaggacaacgcccagaccatgttgatgggccggcccacgctggtg
agcaagaccataccggagacggtgcagcggagcaactcgagcaacgcctccgatctgcag
atgaactcctcgagcttctgcaagatgttcccctggcacttcatcatgaacgagcagctg
gagctggtgcagctgggcaggggcttcagcaagctgtacaagccgtacctggcggacttt
ggttgccaggcgagcacctactttgacttcaagcggcccaagggactgaccatgaagttc
cgggacatagtcaggcgcacctacacgcccttcctgatcggcttgatgagtccgcccggc
gtgtcggacttcccggccatcggcttggagatcaagggccagatggtgcactgcccggag
tccaactcgctgctcttcatcggatcaccattcctggacggcctggacggactcacttgc
aacggactcttcatatcggatatccccttgcacgatgccacccgcgaggtgatcctggtg
ggagagcaggctcgggcacaggacgggctacgccggcgaatggacaagctgaagagcagc
atcgaggaggccaattcggcggtgaccaaggagcggaagaagaacgtcagcctgctgcac
ctcatctttcccgctgagatcgccgagaagctctggctgggctcgtccatcgacgccaag
acctatccggatgtcacgatcctgttcagcgacatcgtgggcttcaccagcatctgttcg
cgggccacgcccttcatggtgatcagcatgctggaggggctgtacaaggacttcgacgag
ttctgcgacttcttcgacgtgtacaaggtggagaccatcggggacgcctactgcgtggcc
agtggcctccatcgcgcctccatatacgacgcccacaaggtggcctggatggccctcaag
atgatcgatgcctgctcgaagcacatcacccacgacggagagcaaatcaaaatgcggatt
ggcctgcacacaggcactgtgctggccggagtggtgggcaggaagatgcccaggtattgc
ctcttcgggcacagcgtcaccattgccaacaagtttgagtcgggcagcgaggcgctgaag
atcaacgttagtcccacgaccaaggagtggctgaccaagcacgagggcttcgactttgac
ctgcagccacgcgattctgcgttcctgcccaaggagttccctaatcctggcggcaccgag
acctgctacttcctcgagggataccgcaatccggccctggacagccaactgccgctggtg
gagcacatcaatgcggccatgaagaccatatccgagggcggcgatgcctag

DBGET integrated database retrieval system