KEGG   Drosophila serrata: 110187672Help
Entry
110187672         CDS       T06108                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dsr  Drosophila serrata
Pathway
dsr00480  Glutathione metabolism
dsr00590  Arachidonic acid metabolism
dsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110187672
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110187672
Enzymes [BR:dsr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110187672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 110187672
NCBI-ProteinID: XP_020812756
Position
Unknown
AA seq 241 aa AA seqDB search
MNLRQFQTISRQAIRCYSSRRSSFTPSALKLTQGQRQSLRFCSVLLPVSCAASIAPASAT
SAASYSTAASIDMSANGDYKNAASIYEFTVKDTHGNDVSLDKYKGKVLLVVNIASKCGLT
KNNYQKLTDLKEKYGESGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVD
VNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGIPINRYAPTTDPMDIAKDIEKL
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcaggcagtttcagaccatttcccgacaggccatcaggtgctattcaagcagg
cgttcctccttcacacccagcgccctcaagttgacccagggccaaaggcagagcctgcgc
ttctgctccgtcctgctgcccgtcagctgtgcggccagtattgcacccgcatccgccacg
tctgccgcctcgtactccacagcagcttccatcgatatgtctgcaaacggagattacaag
aacgccgcctcgatctacgagtttaccgtgaaggacactcatggcaacgatgtctccctg
gacaagtacaagggcaaggtgctgctggtggtgaacattgcctccaaatgtggcctgacc
aagaacaactaccagaagcttacggatctgaaggagaagtacggtgaatccggtttggtc
atcctgaacttcccctgcaatcagtttggatcgcagatgccggaagccgatggcgaggcc
atggtgtgccatttgcgtgactccaaggccgacatcggtgaagttttcgccaaggtcgat
gtgaatggcgataatgccgccccgttgtacaagtacctaaaggctaagcagaccggtact
ctgggcagtgggatcaagtggaacttcaccaagttcctggtgaacaaggagggtattccc
attaaccgctatgccccaaccaccgatcccatggacatagccaaggatattgagaagctg
ctgtag

DBGET integrated database retrieval system