KEGG   Drosophila serrata: 110188799Help
Entry
110188799         CDS       T06108                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
dsr  Drosophila serrata
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dsr01001]
    110188799
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsr04131]
    110188799
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dsr04812]
    110188799
   04147 Exosome [BR:dsr04147]
    110188799
Enzymes [BR:dsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110188799
Protein kinases [BR:dsr01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   110188799
Membrane trafficking [BR:dsr04131]
 Others
  Actin-binding proteins
   Others
    110188799
Cytoskeleton proteins [BR:dsr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     110188799
Exosome [BR:dsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110188799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Titin_Ig-rpts V-set fn3 C2-set_2 C1-set BiPBP_C Ig_4 V-set_CD47 SH3_9 Izumo-Ig SH3_1 SH3_2 SH3_3
Motif
Other DBs
NCBI-GeneID: 110188799
NCBI-ProteinID: XP_020814323
Position
Unknown
AA seq 16126 aa AA seqDB search
MQRQNPNPYQQQQQQQQQQQQVQQYSTQEYSHSSQEQHQQQRISRTEQHVQRSQITTQRQ
VQQLHGGNIGGAYVPPALTHVYAQGDISPPVFEQIFKNARFAQGGNALFEGRLRGNPKPF
VTWTRKGAPLLESQKFRMSYNEATGDVSLLINQIGPGDEGEYTCTARNQYGEAICSVYIQ
PEGAPMPALQPIQNLEKNIYSNGYSYTSIEEEFRVDTFEYRLLREVSFREAITRRSGYEQ
DSQLSQELDRSQGPAQAPQISQKPRSSKLIEGSDAVFTARVGSNPKPRLTWFHNGQRLVA
SQKYEISYSSGVATLRVKNATARDGGHYTLLAENLQGCVVSSAVLAVEPAAETAYEPKPV
DMMAEQLEAGKALPPAFVKAFGDREVTEGRMTRFDCRVTGNPYPEVFWLINGRQVRDDAS
HKILVNESGSHSLMITNVTRLDSGAVQCLARNKAGEVAIEAHLNVLEKEQVVAPQFVQRF
STMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVKATD
AGWYQCTAQNIAGSTANRARLYVEVPREEPSYEQRRLNLPRPTKVIEPEPIPGPEIIYLR
HVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGRVHMEARIEPVGDPTMVVEWFLNG
RPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVSNASGVAESRAILSVVQRPSIEQ
SSQNPNSLQYINQVEDYSRYQRQESSEEQINQAPQFIRPLRDLGEFEEGKNVHFEAQVTP
VNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAIS
QSSIRVHSRSQVTADLGIPEQQRYIEKVEELEDYRKSQQRRHVQEAPEAIAPPQFKTPIQ
NQLDLREHAHAHFEARLEPINDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTI
YDAGTYTCRAYNAMGQDTTVAQLTVISKNEIVSESQHPGGLQKIQHLEDSSRYGRREEEE
TYVTQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLQIEWYHNGRSITAANRIQTYY
DFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMIVETRSSIDTSSMHRGLYEKTQN
LENKQFVEPQYDIEEISKSKPVFVQPLTDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHN
GRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGSAHTSACVRVIDHTDVV
TETQNEQSLEQIQLLEDSRRRHHQEEDITVMQAPQFARALHNIETVEGTNVHLECRLQPV
GDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTS
CSVRIIAKNDLILETQNESGLQKIQYLEDSSRYRRNEFVDEVVNIRPRFLTHPKSLTNTR
EGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVQLIAEDSGVY
TCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYLEDRSRYSRREEIDESTKQA
PVFTTSLKNIEIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVAL
DIMSTLPEDAGTYTCRAFNAVGEAITSAVAVVHTKKSIYLESQHETALPRLQHLEDGSKR
QRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPNLKVEWLRNGQPIEASN
RTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIVQSKTAIQLETQHEAA
MHKIHQLEDHSKYQRREEEEYTVTTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLK
VEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGQAVNSIVLNVT
SRSGIIHETQHEEALTKIQHLEDASRFQRKTDEEQFHAERPQFGRPLRNAKVNEGTPVHL
EATLIPVNDPTMKVEWYCNGTPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNA
VGEAVTTCAVNVTANKTLDLDTLDAQRLEKIRQLESYAPPTKAVVEEKGQKPIFLTPLSN
LEHLKEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRFRTTHDFGYVALDILYVYGE
DTGTYICKATNQLGEAVNTCNVRVLNRRSMILDTQHPDALEKIQKLESKVVNARTEVGEH
PISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDF
GYVSLDITHAVAEDAGEYSVRAVNALGQAVSSTNLRVIPRGTIISDTQHPEGLEKIRKLE
STAPHQRQEPETPGTRQRPVFTQPLQNIDRINEHQTAHFEARLIPVGDPNLKVEWYRNEK
LIEDSSRITKQHDFGYVSLDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSEASIQMD
TQHPDSISRIHQLEKPVAPRPSEPERLFEKPIFTQLLTGPSELWEGAHAHFEARVVPVGD
PTLKFEWFINGVELQMGSRLRTTHDFGFVTLDIAAVVPEDAGVYMCRAYNAAGEAVSSTA
MKVKTRANIDGQPLIPESWEAIRLKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYDKLHEG
QHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSVNGLRADDSAIYTC
KATNQVGEAVSTSSLKIEDRHWLQAESLHPDSLPRIGELEAPKEGRPEAPEPTYETPVFI
THLNNIECKEGDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTN
SYAENSGVYTCKATNSKGSATTSGTLKCTGGKTMFLDTQHPQGETGLEAVQETEEALANR
YANKSAKPETQYPPPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLQH
GSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTTIFCSDKSNIIDSTQHP
KGAEGLEQIQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVG
DQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGTAEISC
NLECVDKPRGQKPRFTSHIQPLQGLKDGQSAHFECTLIPVNDPELKVEWYHNGKLMRHSN
RIKTVSDFGYVVLDIAYLQDHDSGEYVCRAWNKYGEDFTRTTLNCGGRGGVFYDSLQPDS
LQRIRELECPQGQQADTSAPVVAEPPKFITQISDVTKLVEGQSAHFEARLTPITDPDLVV
EWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYECRAYNKYGEDVTRASLKCAS
KASLILDSQLPRGMEGGLEKIANLEYSMVRTRDETTEETKGKAPVFTVPLENIENLREGE
NAHFEARITPTDDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCR
AINEYGEAVTTATMKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTEFVPDDDTGK
PPEFITTPFDMVITENSLAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVI
LEIAGCYQRDTGLYTCKATNKHGEATVSCKLQVKGRQGIVMEPQLPSNFRTGTESLQKLE
ESMHKREEIVIDEEQPNPPKFTEDIKDNLDVPEGGPIHFDCRVEPVGDPSMRIEWFYNGR
VMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTTAKVTCKGKHNIVYE
SQLPEGMTSEKLKELERGRIPEAPKVVEQEFGPPKFTTQITSVTVDEAEAVRFECQVEPK
TDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNHGEDRTK
ATVSCKKLPTILLQNQVPRGMKRSETLTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFV
TQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLYKNRFQPIYDFGYVAMNFG
WVYPEDSGEYVCRATNLYGMDETRAIIKVSGKPGIVYDSQLPAHMQSIDRIREMEASWQV
VPEEVDPDAKPRTKPVFVSKLEPQVVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSR
YKLTNDGMFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLKNSPRP
WYDYELAAYQKERQENELEKVFDERKQVQSEQGAHTLKGVEHLKPKQYKPPTPDWQQNVK
AKKSEDYYNKLQVLETEQLLKETNLRKDNHQYAIPGEKVVSSSQSKGMAQSYEENLQEKT
STTQVKPAPPKGTAEPSESSVHGREVHMNKQQQVQKEIQGDLEITRKITATETTEVEHKG
TIQERVVKGPVKPAKAPVFTKKIQPCRVFENEQAKFEVEFDGEPNPTVKWYRESFPIQNS
PDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGGTAKCSANLVVEERRRAGKGGIQPP
SFVSTIQSTTVATGQLARFDAKVTGTRPFDVYWLKNGMKIQPSIKFKMLEEDGVHTLLII
EPFAEDSGRYECVAVNAAGEARCDGDCIVQSPSKPDKPTTPGSEKAPHIVEQLKSQSVEE
GSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLIISEAFPEDEGTYKCV
AENKLGSIQTSAQLKVRPIENLDAPPTITALKDVSVTEGMPAQFKTTVTGKVKATSVQWF
REGQLIPETPDFQMIFDGNSAVLLIGTTYEEDSGIFTVRVTSSTGQVESSAKLTVKKRRI
SAFQLRTIDSAEDESSSSGREDSAPESPHAFQPGQQPGQQFGQFLGVNGQVQHQGRSRNK
KPKVRSKSLQPPTNIIPWRKSSRPNRGRSLDKGVFLPGFKPEPVKSWTEETISLKATPIE
KKKPTPKLEAATVVLKSIKTERDQGIMSLGATLEQIIAGKTEKEAVPWITMREKLKAVES
VQQQLNKFDLDEVYLRPLEGQIETDEQLPQQAQVEQVQRTKEIQRLKSMESVEIMEMTDQ
IEKLITQQQNNKDRIPWKEMRQQLKSVQRVTKQIDKFKIEEVELRHLQAQQAIAEEFQMG
TADETVIMTIDESSKGSISKVMRRDELQQYEDQSNLYKQQFITTEDVNIMHVSEREKLEA
QRLLREQQAVNWRQQQQRPQLQPLTSVEDTIVSQTTERQKLIQQQSLIEEAQRQQFVQVE
DSQMMSLEQYEHQKMINQSTQHEAFNWRQPREPQKFVQVEDSSLLHLQERQDTQQQQLLQ
QEGVMWERGRKKPEQPQTFQPQPAPAQEEYVDKPRTYEEMHDELVEPVPVQQPQQVPVMW
ERGKKKPQPQPQPQTYEEAHDELVEPTPVQQPEQVPVMWERGKKKVVQEQSITSQEVVLS
SQILEQQIVEETKKTAVRRVIPPREPEQKVEQVSLKPTPRQRPKEVQKAEEFQLKPLKTT
RTVQEAVEQTALKTYEEATDELAEETVPQVQEQPQPVLWERGKKKPQQPEQQVPEIPKTL
EVAVDTLEEDVPKVTEPQPQPVLWERGKKKKPEQQVVEEAPKTLEVAQDTLEEEVAKPEE
PQPQPVMWERGKKKPQPQQVVEEKIEEAPTKTYEEAVDVLPEDTKVEEKPEPVLWQRGKK
KAQKPEPVEEVHPDEVDAQIERVVEEEQVIVEEKRRIKKTKKPKPTKTPSEEVVEDQPEE
EEVPQEEIVEEQVEIVDEKRKVKKTKKPKPTTQVTEEEQPEEEVIEEQEEIIEDQQEIVE
EKRKVKKVXKPKAIVEKTEMEEEQPEEEIPEEEVIEELETIVEEEQAVVEEKKKVKKVKK
PKPTVEKTEVEELEQPEEEVPEEQVEVIEEQEEVVEEKRKVKKIKKPKKIVEEDQPEEEV
QQEEVVEEQEEVIEEKRKVKKVKKPKKKVEDEAEEQPEEIEEPQIEEVEEIQESVPEEQK
KPKPAPQAQEVEQVEKVTLKPAPRKQRPLPEKEQLEEVSLKPLKKTALVSETTQPETPET
EFEVKEQVITTVDQIVDVTKKRVKKKKPKTKTDTEEAIEEPVEDVEEEEEIQPEEEQPVE
EPVEEQPEEETTPEQKVPAKPKPQKQEIIEKVEEVALKRVTRPKKQLPEEATIEEVRLKP
TQRTSIKPEEVTLEAVDLQHVEKTEQEIVQEEKRKVKKVKKPKHEDLPEIPDAEPTKLEE
AEHIDIVKEPKPEEEQPQFPWKRGEKKKPVEDVLEEKQWPTGKRRPLAAEQPQEVQLKPI
PSKPLEEPQKPEKAIPGPQLVPEEKPESEDEELELEPLQLPEDKQPKEPKAKKEKKKKPK
LKKATPSVDEVSEEVAEPFDEPIAEEDEVEVLPVDDDKVVAVSENVLPEEEVVTTEETPE
AKQKAHKKRTKRLKQASVEGQPQLLEAAIAEIEKVDEISQEISQKTITLLKKTEDTRPQF
ITTEQLIELDVEDVRRDLEMKVTSNIIKKEKRRVVLDDSQPLPELELITQKRIQEGIDKV
ADEELIEDQQLIQNQQETTTSEVIGQERKLVKKKKKEIKPPRITEKLRPRQCVPEEPTVL
ECKVEGVPFPEINWYFNDILLFASEKYEITVVEQVAKLKIAKVTPSDVGVYTCEAKNEAG
VATSRTNIILEKEQGVAPQFTKPLKIEFTEEKQPERLKVTVTCQVTGKPNPQVKWYRGIE
EVIPSETVQMFYDEKTGDVALEVINPTPNEAVVYSVQAQNQFGRAIGNANIMSRVDEVPK
EILKAPTVTPLNAVVVPTGGTLLFEAKYDGLPRPEIKWMRNGREVIENEEIIIETTETTT
TIKVINMTRKRTGKYEVWAKNKVGEAKSSGSVVVSDQKPDEQIKPPRFIQPLEPKYFGEH
EVAIIEAVVESEPLSSFQWFVHNEPIKSSNEVRIVSQANKSTLLIEDFQKKFTGPFTCRA
ENVGGSVTSTATVNLIESLPQEEAVEFESPRFIEELIKPVEVMDGEALLLTCQVTGKPTP
KVEWYHNEEKIVENKETTISQDLQGNCQLQITEVFPENEGQYECVATNKIGKSVTKTNVK
IQAFEYIPDSEITGLTGSEEDLLDRTLSIDEQAPKIIKKLPEKIEPKEGEQAKLEVKVIG
KPKPKVKWLRDDEQIFASEEYQIENFDDGTSVLVINHVYPDDLGTISFEAYNPLGVAVTT
ALFAVEGIVGSKDYRKPEWVTHMEEMQVALKDTEQTTDTTHTKQKTPTQKQETRETEITE
VPESVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETSVTVEEMP
VEDEQPEEIKELPEEVRVFETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIEIVQEDDKQ
PETTVTVEEMPVEEEQPEEIKELPEEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVT
KIETVQEDDRQPETTVTVEEMPVEEEQPEEIKELPEEVRVVETISEDGKPKKKKIRTRVI
KKVKGDKQEVTKIEIVQEDDKQPETTVTVEEMPVEEEQPEEIKELPEEVRVVETISEDGK
PKKKKIRTRVIKKVKGDKQEVTKIETVEEDDRQPETTVTVEEMPVEEEQPEEIQELPEEV
RVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIEIVQEDDKLPETTVTVEEMPVEEEQ
PEEIKELPEEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDRQPETTV
TVEEMPVEEEQPEEIQELPEEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIEIV
QEDDKLPETTVTVEEMPVEEEQPEEIKELPEEVRVVETISEDGKPKKKKIRTRVIKKVKG
DKQEVTKIETVEEDDKQPETTVTVEEIPVEEQPEEIQELPEEVRVVETISEDGKPKKKKI
RTRVIKKVKGDKQEVTKIETVEEDDKQPKTTVTVEEIPVEEQPEEIQELPEEVRVIETIS
EDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEIPVEEQPEEIQELP
EEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPKTTVTVEEIPVE
EQPEEIQELPEEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPKT
TVTVEEIPVEEQPEEIQELPEEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIET
VEEDDKQPETTVTVEEIPVEEQPEEIQELPEEVRVVETISEDGKPKKKKIRTRVIKKVKG
DKQEVTKIETVEEDDKQPETTVTVEEVPLVEQPEEIQELPEEVRVVETISEDGKPKKKKI
RTRVIKKIKGDKQEVTKIETVEEDDRQPETTVTVEEMPVEEEQHEEIKELPEEVRVVETI
SEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEMPVEKEQPEEIQE
LPEEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVP
LEEQPEEIQELPEEVRVVETISENGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQP
ETTVTVEEVPLVEQPEEIQELPEEVRVVETISEDGKPKKKKIRTRVIKKIKGDKQEVTKI
ETVEEDDRQPETTVTVEEMPVEEEQHEEIKELPEEVRVVETISEDGKPKKKKIRTRVIKK
VKGDKQEVTKIETVEEDDKQPETTVTVEEMPVEKEQPEEIQELPEEVRVVETISEDGKPK
KKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPLEEQPEEIQELPEEVRVV
ETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEELPLEEQPEEI
QELPELVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEE
VPLEEQPEEIQELPEEVCVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDK
QPETTVTVEETPLEKQPEEIQELPEEVRVIETISEDGKPKKKKIRTRVIKKVKGDKQEVT
KIETVEEDDKQPETTVTVEEIPVEEQPEEIQELPEEVRVVETISEDGKPKKKKIRTRVIK
KVKGDKQEVTKIETVEEDDKQPETTVTVEEVPLEEQPEEIQELPEEVRVVETISEDGKPK
KKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEIPVEEEQPEEIKELPEEVRV
VETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPLEEQPEE
IQELPEEVRVVETISEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKLPETTKPET
IVTVEETDNRSPSVGKTKLKKRVIVQKPEDEVTVFELPERKSVILSEKEDGTPTKTVIKT
KIIKKIQGPHMEVTKVQTVEEYEKTPQTKVTVEKFELPFPELPEEKISEVIVLPDEVSEF
ETIDEEGHPKIVKTKKRVIKKPAFGNNEEVTEIGIIEQDNTEPLYSVTIKEQPITYSQPD
DSKLVELPEQVTEMEITSPDGTKKKKTVKSRAFKKSIDDKRDEVTTVNIIEEEDKEPLTT
VQIEVVPSDEVSITPIPIEELPEETVFTEELDDNKKPRKKTTKTRTFKKQGPADEEYFQI
QTIEEEGKEPYALIRVVSDENIADIIDISKLDDEKVSKHKQKPHKHKVEKPKIDNTETEH
PVYITTFKSVQNDDGETTIQSENKRVSQEEGILVEEVLSDTEPIPEDTTQSHLEIIEVNE
PSDQYNKEYTITEPEEASADVKQTPVKDKXPKQKKTLETPIEEVDETVIEEQSTEEPTDK
TIKKRKSKKLVGKVEETSADEKPVEEKGKPRKKKVVKSKRDELDEYIQFLIHQEIPKTVL
QEYKRTDMEHPQRARRDSSFKQPVKLTPMKIERVEFRKPEKVEISSVEEFPQMLKLKAPK
QRPQEEKKKKNEASFXNKKLKSWIRFIPYAPYCFPYVVTELENTCDHGELSRNVKEAEEV
LKFRPKKFKHTKPEKAELEQSDLPTLDSEKAEPSDKEQPKPKYQRGKKTEKETTEESRKI
KLGKGKLPENVESVEEVNLKPVKKDIKEDDVSEEPVKVAEEEVVKKKKTKKPDKSGEGLQ
FQPTEFKDIESTFEFPEESDESLGEEMHTDDKPKYKRKKKPIPTPEQDKYEISPGKPREL
EEVPEEGLKLRKKQGQKPVDEKEGLKLKPFYKLEVIELEPENATDEELPITGKLTKEPKK
KRKLRLKTEQEDNTIDIVEVSPKXTDDKIYEVTITSSEIVQDDKKESNVRKKKVKRMNKT
ELDDFVSELQEEPDQKFYETTTHDFYEVKLTELEPENDSGVDDQQEIEKPKKRRIRHEKG
DEVEILEIVETVAAPGEEPLYEITITSSDSKTEEFGTQPVEKPKKRTKKMKKDELDAYIQ
QLINAEIPITELEKYEKIDVDGKPKKPKKQKVKHEKSIIDEGETLQVGVTEHEPVEKPKP
KKQKPKKVTKVEETVESEEVPVYDEYLIKKIDAERSPEQDIEKPEEEILTALDEIITELT
ETMPIIVVEEDFVSVSLPSEVVHDTDQKIIKKRKVKTRKGSKHYEIEIIETEASNDKPEE
AEVIVITTEISEDTTDGPAMVKPEAPKKLVKKVKKEKLKEFIVNVVEEAPLEHLVEISED
LTITPEKEDSVEQDIIAFTTTVVDEETVPDVIPDHSKPEEAVSLPKDKKKKTDKQKKVKV
SETEPVSTTDDSKIAEHTAVISQSHDSPQADEYLVDVKDTLPKGKKKSVKKPKEKSFDEP
ISEYTIRIEELAPETVVEKVNEEGAEVERVITKRKLKKKDGPKEYLIEVVETYEENKPES
DIVIQTIDITPETDTKPQEEHKIKIVKKRKPKTESLDDFIHELIEQDIPKTDLEEYEAPV
TETSPEAKKPTKIKKHHKKTTEIIDGVPITVYEISVQEFESEQDDVKPDEVALVETESGD
TAEPYEDLEVKVLESKPKSKSKKSFKTKVVEDVQPQPILEDIEESVEIVQVTEEDGVPKQ
VEVKKKKVLRKQGPKEQIFEVTETKTSDEPLAEVTIVELTEKQQPKEDVVQPKEKKPIKK
PKKLKPEDVKNYVVNVLDELIEPYKFEDTEQPVITEIAESVEVVQVTEEDGVPKQVEVKK
KKVSRKQGPIEQIFEITETKTSDEPLAEVTIVEVTEDQPKEDVVQPKEKKPIKKPKKLKP
EDVQDYVVKVLEEFVEPYKFEEPVITEIAESVEIVQVTEEDGVPKQVEVKKKKVSRKQGP
IEQIFEITETKTSDEPLAEVTIVEVTEDQPKEDVVQPKEKKPIKKPKKLKPEDVQDYVVK
VLEEFVEPYKFEEPVITEIADSEQEEQALSKPKKSTKKPVEKTVLIEEMAPETIIEDIVN
DEGEEVKQIKTTKKLKKKEGSKEYVIEVTETYQENKPEAEIEFTTIEIPTEDSPQITEDQ
PAKVVQKVKKKKPVKDDLDKYIQQLIEQEITKTTLEQYEPTEMDAKPKQPKKKVKTHHKK
TVEDVDGLPVTIHEFNVEIEPVSEDLKPLEILPEDIEETPQKPDDSSNYIVNISDEFVES
DQPTEKSPEEEQKPTKKEKSLKKKKLTEVPVPLTEIEQTVEVVEQPTEEGEVKEITVKKR
KVSRRKGSKEHVFEITETTSDDQPIAEVTVVELTSDDVLVSEEKPKPEKKIIKKPKQLKM
EEVEDYVINVIEEFVEQVPVEVVDSDAVKVEEEAPKKPKKISKKYTVTEQETPESNVPEI
VEDAPVQPVEDVPQQEIETTDFSIGIKEDTVVDEKKQPKSKKVTKTKQVQEPVSEENKEY
LVTLKSEESVRQEEQPKNETAVVEVQDDKPSDQPSFQIEEIETVAIEQEVIDDKGETAKQ
TVTKRKIKKQLGPKEEIIEIVETKTGDEPEYEVIVTTQDAEIVDEEVPQEEKPKKIRKAK
KVPKDDLQDYIQKLIEQDIPKTELEKYEKIDLDEPVKMKKKPVKKVKVSEEQPTEEAEEQ
LEDKPLEEKTQASEEENDEPLLTFTVKEFIPEKPEETTFEIVVLEETVETKQVPDEEGKI
REKVVKTKKIKQKKGPEEVVHDIVEVTDKDTNESEITVITTSPTETPDQEEPVVKQKRTK
KVKKDDVEDYIKAVIEEEAPKPALPDDVVVVVEDSASKPTSEKPKKKTKKEKQPVPEEEK
PKEDEISIVETIKEDAPVTDDLITMQESIPSVEEPELEIDQVEEIKKPEKKKKPKAKVTV
SEEVPQEVLDEQPLEVTEKESDIEKPQQQEFNISVKEEDKPEPKPEKRRRQRKSXEESDQ
PLEEKYEISIKESDLEPAGEKPFTIEIIESETKVEETTDDTGEVHKQVTTKRKLKRPDGE
GEIEIIEVVRDDQPEAEITIVEYEPEPVQQEEKPKEPXKKTKKVKKDDIHDYIQKLIDME
TPKTELEKYEKIEFEPMVKDKPSEHQVDVVEETPSEKPKKDKKTKSKPVPNEESSVPDQF
AEVKIVEEEAPEQPLVPVEVVEIQPVEVEIQEVVSEEGKPIQEKTTKRVLKKKGPKEETT
FKITTIENEDTDSVTVIVDEEPDIVPIQAVEDKPEQTEEKPKPKPKKTVKKVKKDDLDDY
VKKLIEEEIPKPDLEKYEKVEIPAESDKPASSEVAPAEVKLDLTEPIPIADDSAKPKKTK
TPKHKTIATDETIQDKPTDKIVDITDTTEITPNQIAQPEDTATAQITPSAQEDKPTQDDT
KDTIQKTVKHKKTKPDTQKSVETSEVPEVQKDYQISIIHEEPVEEEQPQKILEVRVIDEV
AEVEESQPIVEEVEEDEEQPITEDTPEDVTKPKTKKKKVVKKKTDDHDEIIRKLLEQEIE
KTELEKYEKLEFDLPKKLKPEFASLEPMKIERKEQKPTKVTIVEAADVPKTVKLKPGKRK
EKPAEEQSVQLPKFRLKTRMVIVEFPPAPLIPKLTRIGATKDNGELSRNIEEAEEALKFK
PHKTKKIKKIKDDLEKVELEKYEKYVSSEEEPEEKAPYQKPEKAPKPEEKQEDVKIKLGK
GKKKPKEDEEPENVTLKKIPIKPQEVEEEVELKAKPKEVVVVEEQAKEPKEGQFNVEPFE
PVEFDRPEYEPEELEPIEHPDMPEKPKKPLKTKYKPKEKSKPEPETIISEIVPGVPKEQE
EIPEEEIKFRKPERKAPEETDSEIKLRPVPKAPQAEEPAEEAIVRPKVEEPQPEVPEVKS
DDEAKKPKKAKSKKVQPKEEELPEQRPEDYEISVKEEEAPLKKPVEIEQPKEVKVKQKKP
KETPVSEVEVTEEIPQPEEVPEEIPVEYKITTTVLEPEEAPKEHQVRVIDSDERQETTEE
VIEEKVVTRKKKPKPQQPEEFEVTLKEPKEEEQPVEEVSAEIVLPVEQPEQMPEEFEVEL
KMTEPTPEKPVEQEITVKEKTKKKLVKEVKGDKIVVVEEEEKIQPVEEQVVEVEKQEEKK
KTKKPTSYEFSVTETEAIEEKPAEIVEETPEETPIVLEEKVVEKFDSYEITLKESEAEKV
TAVEEQPEEEIPQEVVLKKKPKKPEEFEAEVVLTEPKVTEETTVETEIKQKKVKKPKKTE
DEAQLEIKVVESEAPVSEEVIVETAKPEIVEKQEVVVEEKPEEFSIRVSETEAKPEEPSE
AQFTVKKRKPSVTFADEPATEIILKESKPVEEVTEEAQIKTKKPKKKVKDVEAEELKITI
TEETPQEVPIVEEVEEEEVVTVVKEEVPKVEDKTYTFGIKETQPEKPVEVIAKEEPVVAE
PIVEEPQPEVFEEHKVKVIEETPREVVEEVVEEEVKVIRKKKPKPEAKDEPEAEVTVSAP
RPVDEVEATSSITVVPEQPTEEEAADLKITIIEEVAPPQDLVQEIEEIEIVEKPKAPEET
PADFSFAIKEAEKEPTVEELPEEQVTIQKKKKKAPVAEVVEEPEAEFMMKPKQPVQEVSE
EAKIKKKSKKPVAQEEAAAELKVTITEDVPTESEVQEIIEEIEEVPEEKPAEYTIGVKET
EPEAPKEEEVSLPKKKPKAIPVVEEPEAEVTLKPKPKVEEVEEEAKIVKKKPKKPVEEAA
AEDLTVKVEEEVIPEPIVEEEIIEEVQIKKKPEPTPEDIVDAAVVKLKKPQPEKADEVVA
EVTLKPKAPKEVQEEEFSVDVKLPKEQKVTEETSDQTVQLKKKKKPQKPVEEAAAELELK
QTVIEERPVEIEEEEIVEEAVIIRKKPKKPFEPTVEDLEETEFSLSFKKPHTINEGVEEA
ATVLKKRPVKPTTMDEAAAELSIKRQQEEYEEGEDIEEFVVSQRAKPKPLQITEEGEEAY
TVKKLKKRKQVDIPEYADVENVTFRAKTTKTKEDVDQEFNIALDSYAEEEISMSGKVKLK
KPIKKTFSEAADEAHIKIMHDYDDGEEPIIEEIRDDEDTIDEVEEPEEYFVEELPPDDVD
FKLKPKKQPKPTYSVQDEEEEQFLIGIRHPKRDSVTYDEDSLTFKKKRKVVQQLFNEDGA
SLNITREMNVEESENPNVMYSICNYIADNDEAINLVEGEKVTVIGRHSSEWWYVKKSITE
EEGWVPAQYLMEPDEYAQYVQNKLHEKIDKLPVFERPGPEDKPIAPRFIEKLQPIHTPDG
YTVQFECKVEGSPRPQIAWFRETAIIKPSQDFQIFYDDDNVATLIIREVFPEDAGQFTCV
AKNAAGFTSSTTELIVESPLSDHGSDATALSRRSMSRESSLADILEGIPPTFSKKPKAQY
VDENTNVILECRLVAVPEPDIVWTFNGVDIDEEELKNVRIVTESDMHMYCSVVHITKVKK
SQEGIYEVIATNREGEARLPITLKVRTTDQEAPQILEPLRNMVIREGESVVLSTQIVGNP
PPKVTWYKDGKPVKNAKSDKDLHTLTLITPKKSEKGEYTVKAVNPLGNVETTANLTIEEA
TSGNAEPPLFVERFEEQNVPQKGEIRLPAKVSGNPVPEVQWLFNNSPLFPSERIQQVYDG
ENIELIIKDANPETDSGDYKCIASNPIGKTSHGARVIVEVDEVTFTKKLKKTITIEEVQS
LTLECETSHVVTTKWFFNGKELSGMDHRVVVEDGKTHKLVIRNTNLRDSGTYVCKVKKQE
TQSTVEVLQRKPDFIKVLEDYEVTEKDTAILDVELTTEATEVTWFKDGEKITPENKNVEF
IKDGKARRLVIRDTTIHDEGQYTCKIEGQECSCELVVIELPPEIVEPLKDVSVTKGENAT
LEVELSKGDALVKWYRNGKEIVFNERIQLAIDGKKQSIRILKAKPEDVGEYSIQVGEQTS
KAKLTVEEPLVNFVVPLPDVTLATKTTDAEFTVELSQPDVEVTWCKKGKPIKPNKKHEVF
VEGTVRRLVIHDANDDDAGEISCVAENVTSSTKLCVEELKLPPVITSDKDQTIKVKEDDD
AIFTVKYTGVPTPEAIWTTRKVVIPKSKRTIPAIDEQSATLTIKKVVDDDEGEYTVKLVN
PVGEAEASLHLVIMRKPTAPGTPQPLEIMHDSITLYWKAPEDDGKSEIIEYILEYHDVKE
EKWTEIRKIKDTTYTISKLKIDTEYVFRSIAVNEVGPSPPSPASPPIRLVPKVETEAPSV
REPLQDVVSELDKEVTLSCVFGGIPEPKVTWKKNGKVFESSNQRYENRVAKYTIEKTTIE
TEATYTCVATNEKGTVETSCRLKLQQKPVLEVEDKYLTQKIRTGSTLTIPATVRGYPQPT
VTWHKETVEQKTTKTVTIETTETTSTYTVKKVTREFSGKYKVTATNESGSTYVECTVQVI
DKPSRPQSLEIKDVKKDSITLEWTPPIDDGGLEINKYILEKCDVQNNVWMKVSDFDKTIK
SYAVQKLSMNSQYMFRVVAANPIGESEPTESDPVTITKKFEKPSPPRGPTTVSGMNDTSF
NLAWEPSENDGGSKIIEYIVEIREETETIYRSVGTSLGTVTNIHVEKVVRNKGYLFRIYA
RNEAGTSEAYETTEKIVVGRKITPPSPPQNLRAPDVTSRSVTLDWEVPARNGGSEITGYC
VEKRSSTSTTWSKVITLDAHQLHYTIDNLKEKCEYWFRVSAENEAGLGAPAVTESVSLKT
HATVPSPPTAPLEARVLAANAHIFEWGIPESDGGAPLLGYHIAIRDMKKTMWIEVGRVPA
GVQKFQIRDLQENHEYMIRIFAKNEIGLSEPLESEEPYKVMTAGHESLPDEPRTEMSTCN
TSSWLRDHNMDADIHSYARGRLLQRDEYFFRLWAEIPKSKKKKSSK
NT seq 48381 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgacaaaatccgaacccgtaccagcagcagcaacaacagcagcagcagcagcag
caggtgcagcagtactccacgcaggagtactcgcactctagccaggagcagcaccagcag
caaaggattagccgcaccgagcagcacgtccagcgcagccaaattaccacccaacggcaa
gtgcaacaactccatggtggcaacatcggtggcgcctatgtgcccccggcgctgacacac
gtgtacgcccagggtgacatatcgccgcccgtgttcgagcagatcttcaagaatgctcgc
ttcgcccagggcggcaatgccctgttcgagggacgcctgcgtggcaacccgaagccattc
gtgacctggacccggaaaggcgcaccccttctcgagtcgcagaagttccggatgagctac
aatgaggccaccggcgatgtgtccctgctgatcaaccagatcggacccggggacgagggc
gagtatacgtgcacggcacgcaaccagtacggcgaggccatctgcagcgtctacatccag
ccggagggcgcaccaatgcccgccctgcagcccatccagaatctggagaagaacatctac
tccaatgggtattcgtacacgtccatcgaggaggagttccgcgtggataccttcgagtac
cggctgctgcgtgaggtctccttccgtgaggccattacccgtcgttccggctatgagcag
gactcgcaactctcgcaggagctggaccgtagccagggtccggcgcaggcaccgcagatc
tcgcagaagccgcgcagctccaagctgatcgagggctccgatgccgtctttacggctcgt
gtcggttctaacccgaagccccggctcacctggttccataatggccagcgcctggtggcc
tcgcagaagtacgagatctcctactccagcggagtggccactctgcgtgtgaagaacgcc
acggctcgcgacggcggtcattacaccctgctcgccgagaatctgcagggctgtgtggtt
tcatccgccgtgttggccgtggaaccggccgctgagactgcctacgagcccaagcccgtg
gacatgatggccgagcaactggaggcgggcaaggcattgccccctgccttcgtgaaggct
ttcggagaccgcgaggtgaccgagggtcgtatgaccaggttcgactgccgtgtgactggc
aatccctatcccgaggtcttttggttaatcaacggacgccaggttcgtgacgatgcctcc
cataagatcctggtcaatgagtccggaagccattcgctgatgatcaccaatgtgactcgt
ctggattccggcgctgtccagtgtctggcccgcaacaaggccggtgaggtggccatcgag
gcgcatttgaatgtgctggagaaggagcaggttgtcgcaccacaatttgttcaacgcttt
agcaccatgactgtgcgtgagggtgagcccatcacgatgagtgccaatgccattggcaca
cctcagccacgcatcacctggcaaaaggacggcgtccagatctcgtctaccgccgagcgc
ttcgtgggcatcgacggcggcgccacttgcctggagattccacgcgtcaaggccaccgat
gcgggttggtaccagtgcaccgcccagaatattgccggatcgacggccaatagggcccga
ctttatgtcgaagtgcccagggaggagccaagctacgagcagcgtcgtctcaatctcccg
agaccaacgaaagtcatcgagccagaacccattcctggccctgaaatcatttatctgcgc
catgtagagcgcgccaagccccatcttcgccctggcgaggaagaccgcgtgtatccgcca
ccgcagttcattatcccgctgcagaatgtgcagcaaaccgagggtggacgtgtccacatg
gaggcacgcatcgagcccgttggcgaccctaccatggtggttgagtggttccttaatgga
cgccctctggcagccagtgcccgcgccacgtccgtcttcaagtttggctttattgccctg
gatctgctgagcatcatgggccatgattccggcgaatacatgtgccgtgtgagcaatgcc
agcggagtggccgaatcccgtgccattctctccgtggtgcagcgtccctccattgagcaa
tcatcacaaaacccgaatagcttgcagtacattaaccaggttgaggattactcgcgctac
cagcgccaggagagctcggaggagcaaattaaccaggcaccgcagttcattcgcccgctc
cgcgatctcggcgagttcgaggagggcaagaatgtgcactttgaggcgcaagttacgccc
gtaaatgatccctccatgcgcgtggagtggtacaaggatggcctgcccattacagccagt
tcccgcatcaccgccatttttaactttggctacgtctccctgaacattttgcacctcagg
gctgaggatgcaggcacttataccgtgcgtgcggtgaaccgtattggcgaggccatcagc
caatcatcgattcgtgttcactcgcgttctcaggtcactgctgacctgggtattcccgag
cagcagcggtatatcgagaaggtggaggagctggaggactaccgtaagtcccagcagcgt
cgtcatgtccaggaggcgcccgaagctattgctccgcctcaatttaagacaccgatccaa
aaccaattggatctgcgcgagcacgcgcatgcgcactttgaggcgcgtctggaacccatc
aatgattccaccatgcgtgtcgagtggctgaaggatggacaacccctggaggccagttcc
aggatcaccacgtaccacaactttggatatgtggctctgaccatcaagcagctgaccatc
tatgatgccggcacctacacttgccgtgcctacaatgcaatgggacaggacactaccgtg
gcccagctgacggttatctccaagaacgagattgtgtccgagtcgcagcatccaggtggt
ctgcagaagattcaacatctggaagactcatcccgctacggtcgtcgcgaggaggaggag
acctatgtcacccaggctccgcgcttcctgggtcccctgaagggtaccaccaagatcctc
gaaggacagcgtgcccatttcgaggcccgcgtggaaccccagagtgatcttggtctgcag
atcgagtggtaccacaacggtcgttccatcaccgcagccaatcgcatccagacctactat
gactttggctacgtcgccctcgatatctcgcaggtgcgcgccgaagatgctggcgtctac
cttgtggtggcgaggaacaagctaggtgaagctcagcagcaagcaacgatgatagtggaa
actcgttccagtatcgacacatctagcatgcaccgcggtctgtacgagaagacccagaat
ctggagaacaagcagttcgtcgagccgcaatatgacattgaggagatctccaagtccaag
ccggtgttcgtccaacctctgaccgatccaaagcccatccatgatggcaagaatatccat
ctggagtgccgtctggagccaatgggtgatcccaccatgcgcgtcgagtggttccacaac
ggtcgccccgtaactgtgggttcccgcttccgcacctactatgactttggttttgtggct
ctggacatcatcaaggccacggccgccgattccggagagtacacagtgagagccaccaac
cacttgggttcggcccacacttccgcctgtgtgcgtgtgatcgatcacacggatgtggtg
accgagacccagaatgagcaatcgctggagcagatccagctgctggaggactcgcgtcgt
cgccatcaccaggaggaggatattaccgtcatgcaggcacctcagttcgccagggccctg
cacaacattgagacggttgagggtaccaatgtgcacctggagtgccgtctgcagcccgtg
ggtgatcctagcatgcgcatcgagtggttcgtgaacggtaagccagtgaagacaggccat
cgtttccgtcccgcctatgagttcgattacgtggccctggatctgcttggttgctatgcc
atcgattcgggtgtctacacctgccaggctaggaatcagctgggagaggctgttacctct
tgttccgtgcgcattatcgccaaaaacgatcttatcttggagacgcagaacgaatctgga
ttgcagaagatccagtatctggaggactcgtcgcgttatcgtcgcaacgagttcgtcgac
gaggtggtcaacattcgtccgcgtttccttacccacccgaagagcctgaccaacacgcgt
gagggtggtcacgcccactttgagtgcaaaattgagcccgtgacggatcccaatctgaag
gtagagtggttcaagaacggtcgcccaatcactgtgggccatcgtttccgtcccatccat
gactttggttatgtggccctggacattgttcagctgattgccgaggattctggagtttac
acttgccgggctgttaacctgatcggttcggatgaaactcaggtggaactgcagtgccgc
agcggtgagcagattgtcactgtcacccagaacgaggctggcttggagcagatccactat
ctggaggatcgatcccgctacagccgccgcgaggaaatcgacgagagcaccaagcaggct
ccagtgttcaccacttccctgaaaaacattgagatcaaggagaaccagagggctcacttt
gagtgccgcctgattcccgtctccgatccatccatgcgcgtggagtggtaccacaataat
ctgccactgaagtctggttcccgtttcaccgagaccaacaactttggctttgtagccttg
gacatcatgtccacattgcccgaagatgccggcacctacacctgccgtgccttcaatgcc
gtaggtgaagccatcacctctgccgtggctgttgtgcacaccaagaagtccatctacctg
gaatcgcagcatgagaccgctctgccacgcctgcagcacctggaggatggctccaagcgc
cagcgtatcagcgtccaggatgagtttgtgtcccaggctcccgtcttcaccatgccggtg
agggatgtccgtgtggccgagaaccaggcggtgcactttgaggctcgcctgatcccagtg
ggagatcccaatctgaaggtagagtggctgcgcaacggtcagcccatcgaggcctctaac
cgcaccaccaccatgcatgacttcggctacgtggccctcaacatgaagtatgtgaaccca
gaggactctggcacctacacctgccgggctgtcaacgagctgggtcaggcggtcacctcc
gcttcgctaattgtgcaatcgaagactgctattcagctggagacccagcacgaggctgcc
atgcacaagattcaccagctggaggatcatagcaagtaccagcgcagggaggaggaggaa
tacacggttaccaccgctcccgtgtttgttaccaagttgattggacctagcaacctggtt
gagggccagagcgctcactacgagtgccgtattgaaccctatccagatcctaacctcaag
gtggaatggttccacaacggcaagcccctgagcactggtcatcgtttccgtacgacctat
gactttggattcgccgccttggacatcctgactgtttatgcagaggacagcggcgagtac
acttgccgcgtgaccaacaatctgggtcaggccgtaaactcgattgtcctgaatgttacc
tcccgctcgggcattatccatgagacccagcacgaggaggctctgaccaagatccagcat
ttggaagatgcgtcacgcttccagaggaagaccgacgaggagcagttccacgcagagcgc
ccgcagttcggacgccccctgcgtaatgccaaggtcaacgagggcactcccgtccatctg
gaagccacgttgatcccagtgaatgatcccaccatgaaggtggagtggtactgcaacggc
acgcccatccaaacgggtcaccgctttaagaccacctacgactttggcttcgtggcattg
gatattctgtatgcccatgccgaggataccggcacctacatgtgcaaggccaagaacgcc
gttggagaagctgtcacgacttgtgctgtaaacgtaacagcaaacaagacactcgacctg
gacaccttggatgctcagcgcttggagaagattcgccagttggagagttatgcgccaccc
actaaggccgtggtggaggagaagggccagaagcccattttcctcaccccgctgagcaac
ctggagcacttgaaggagggcgagcatgcccacttggagtgccgagtggaacccattaac
gacccgaacctgaagatcgaatggttctgcaacggtaagcagctgcccactggtcatcgg
ttccgcaccacccacgactttggctacgtcgccctggacatcctgtacgtctatggcgag
gataccggcacctacatctgcaaggccaccaaccagctgggcgaggctgtcaacacgtgc
aatgtgcgcgtgctgaaccgccgcagcatgattctggatacccagcatcctgatgctctt
gagaagatccagaagctggaatccaaggtggtgaacgctcgcaccgaggttggagagcac
ccgatcagtccgcctcacttcaccgctgagctgcgcggctccactgagatctatgagggc
cagactgctcactttgaggctcaggttgctccagttcacgatcctaacttgcgcattgaa
ttctaccataatggcaagcccttgccctcggcttctcgcttccacatcacctttgacttt
ggttacgtgtccttggacatcacccatgccgtggccgaggatgccggagagtattccgtg
cgtgctgtgaacgccttgggccaggctgtgtcgtccaccaacttgagggttattcctcgt
ggcaccatcatttcggacacccagcatcccgagggtctggagaagatccgcaaactggag
tctacggcgccgcatcagcgccaggagcccgaaaccccaggcactcgtcagcgcccggtg
tttactcagcctttgcagaacatcgacaggatcaatgagcaccagacggctcacttcgag
gcccgcctaattcccgtgggagatcccaaccttaaggtggaatggtaccgcaatgagaaa
ctcatcgaagatagttctcgtatcaccaagcagcacgactttggctacgtctcgctggat
atttcgcacatccgcaaggaggatgagggcgtgtacatgtgccgcgctgtcaatcctctg
ggtgaggctgtgaccaccgcttccatgcgtgtggtgtctgaggctagcattcaaatggat
acccagcatccggacagcatcagtcgcattcatcagctcgagaagccagtggctccgcgt
cccagcgaaccagagcgtctgtttgaaaagcccatcttcactcaactgcttactggacct
tcggagctttgggagggcgctcatgcccactttgaggcccgtgtggtgcctgtgggtgat
ccgacactcaagttcgaatggttcatcaacggcgtggagctgcagatgggctcccgtctg
cgcaccacccatgactttggattcgttaccttggacattgctgctgtggtgccagaggat
gccggcgtctacatgtgccgtgcctacaatgccgccggtgaggctgtatcctccactgcc
atgaaggtgaagacgagggcgaacatcgatggccaacctttgatcccagagtcctgggag
gctattcgcctgaaggaggctgccatgaaccgtgttcccgagatgtttgtggactcgact
ccacaacaggccccggtgttcaccacccacctgcagagctacgacaagctccatgagggt
caacatgtgctcttggaagctcaggtggagccgcgtgcggatcctaaccttcgcatcgaa
tggttcaagaatggtatttccctgaccactggctcccgcatccgcagcaccttcgatttc
ggtttagttacgctgtctgtcaatggattgcgtgcggatgactctgcaatttacacttgc
aaggccaccaaccaggtcggcgaagctgtctcgacctcctcgctcaagatcgaggatcgt
cattggcttcaggccgagtccctgcatccggattcgcttcctcgcatcggagaactggag
gcgcccaaggagggacgtccagaggctcctgagccgacttatgagacacccgtgttcatc
actcatcttaacaacattgagtgtaaggagggcgacaatgtgcgcttcgaatgcaacgtg
gaaccggctcgtgatccgaccatgtccatcgagtggttctacaatggacagcctctgcaa
gctgccgccaaattcaagtctatctacgatttcggctattgcgctttggatctgaccaac
tcatatgctgagaatagcggtgtttacacctgcaaggccactaacagcaagggttcggcc
accacctcgggtactcttaagtgcactggtggcaagaccatgttcctggatacccagcac
ccgcagggtgagactggcctggaggccgttcaagaaaccgaagaggctctggccaaccga
tatgccaacaagtcggccaagccggagacgcagtacccaccaccagtatggaccaagcct
ctgcaggctgagttccatctgtcggaggctcaaccgatccatttggaggccaatgtggag
cccaaggaggatccgaacttgttcatcgagtggtactttaacggcaagatgcttcagcat
ggttctcgtttcaagatgaccagcgagtttggatttgtgactatggatatgatcgaagtg
tatgcccgcgaccagggtatttacacgtgcaaggcttacaataaggccggtgaagccttc
acctccaccaccatcttctgttcggacaagtcaaatatcatcgactccacacagcacccg
aagggagctgaaggcttggagcagatccaggacctggaggattctctgcgcaaggacggc
tctaagccggagcaaccagatctgggaattccaccacgcttcaccaccgaattcgttaac
atcgccgacattggtgagggtgaactggcccactttgaggccaatctcatcccagtgggt
gatcagagcatggtcatcgagtggttctataacggcaaggtgctggaagccagccatcgt
gttcgcaccatctacgcctttggcactgtggctctcgaggtcctcggaacgaagattgag
gataccggcacctacacttgccgtgccaccaacaagcatggaactgccgagatcagctgc
aacctggagtgtgtggacaagccaaggggccagaagccgcgcttcacctcccacatccag
ccgctgcaaggcctgaaggatggtcaatccgctcactttgagtgcactttgatccctgtc
aacgatcccgaactgaaggtcgaatggtaccacaatggcaagctcatgcgtcactccaac
cgcattaagaccgtgtccgactttggctatgtcgtgttggacattgcctatctgcaggat
cacgacagcggtgagtacgtgtgcagggcgtggaacaagtacggagaggacttcacccgc
accaccctcaactgcggcggtcgcggtggcgttttctacgacagcttgcagccggattcg
ctgcagaggatcagggaactagagtgcccacaaggacagcaggccgacacctcggctcct
gtggttgctgaaccacccaagttcatcacccagatcagcgatgtcaccaagctggtggaa
ggacagtctgctcactttgaggctcgcttgacgcccatcaccgatccagacttggttgtg
gaatggtactttaatggcaagaaactgccacatggtcaccgtttccgcactttccacgac
tttggcattgttattctggatattctctactgttatgaggagaattccggagtgtacgag
tgcagggcttacaataagtatggtgaggatgtgacccgtgcttcactcaagtgcgcctcc
aaggctagcctcattctggactcccagctgccgcgaggcatggagggtggtctggagaag
atcgctaatctagagtacagcatggtgcgtactcgcgacgagaccaccgaggagaccaag
ggcaaggctcccgtcttcactgtgccgctggagaacattgagaatctgcgcgagggcgag
aatgcccactttgaggctagaattacgccaactgatgatcccaaactgaaggtcgaatgg
tactggaacggacgcccattgaaggccggctctcggttccgcactttctgcgactttgga
ttcgttattctggaaatctctcccgtgtatcccgaagattccggcgaatactcttgccgt
gctattaacgagtatggtgaggctgtgactactgccaccatgaagattcagggcaagcgc
agcatcattatggaatcgcaactgccaaagggcatggaaggaaccatcgaccgcattgcc
gaactggagggattgggctcccgcagcaccgaattcgtccctgacgatgatactggcaag
ccgccagagttcatcaccacacccttcgacatggtaatcactgagaattcgttggcccac
tttgagtgccgcctgcagccaatcaacgacccatcgatgcgtgtggattggttccacaat
ggcaaggccttgtgggctggctcccgcattaagaccatcaatgacttcggtttcgtaatc
cttgagattgccggttgctatcagcgcgacacgggactgtacacttgcaaggctaccaat
aagcacggcgaggctacagtctcctgcaagttgcaggttaagggtcgccagggcatcgtt
atggagccccagctgccttccaacttccgcactggcactgagagcctgcagaagctggag
gagagcatgcacaagcgcgaggagattgtgatcgatgaggagcagcccaacccacccaaa
tttaccgaggatatcaaggacaatttggatgtgcccgagggaggtccaattcactttgat
tgccgtgtcgagcctgttggcgatccgagcatgcgtattgaatggttctacaatggccgc
gttatggccactggttccagggttcaccagcttaacgactttggttttattgccttggat
gtggattacatctatgccagggattcgggagaatatacttgtcgggcgactaacaagtgg
ggcactgccaccacaaccgccaaggttacctgcaagggcaaacacaatattgtgtacgaa
tctcaactgcccgagggcatgacctctgaaaagttgaaggaactggagcgtggacgtatc
ccagaggccccgaaggtggttgaacaggagttcggaccaccgaaattcaccacgcaaatc
acttccgttaccgtggatgaagctgaggccgttcgatttgaatgccaggtggagccgaag
acggatcccagcctgcgtgtggaatggtatcgcaatggcaagccactgccctctggacat
cgttacagaaacattttcgacatgggctttgtgtctctggatattctctatgtgtatgga
gaggactctggtgaatatgtttgccgagctattaacaaccacggcgaagatcgcaccaag
gccactgtctcttgcaagaaacttcccaccatcttgctgcagaaccaagtgcctcgcggc
atgaagcgttcggagactctgacccaaatggaggccaccatcaagaagtacacctccgag
gtccatttaaccgaagacgatctgttcgatcccgatcgcaagcagcctcctcgctttgtt
acccagattaaggaacagctcactcttaccgagatggccgtgaccaagttcgagtgccag
ctggcccctgtgggtgatcccaacatgaaggttgagtggttcttcaacggcaagcccctg
ctgtacaagaaccgtttccagcctatctacgatttcggttatgtggccatgaacttcggt
tgggtttatcccgaggacagcggagagtatgtttgccgtgccaccaacttgtatggcatg
gatgagactcgtgccattatcaaggtttctggaaagcctggtattgtctacgattcacag
ctgcccgctcacatgcagagcattgaccgcatccgcgaaatggaagcctcatggcaagtg
gtacccgaggaggttgatcccgatgccaagcccagaaccaagccggtctttgtgagtaaa
ctggagccccaggttgtggaggagggcgatccagcccgcttctgtgtccgtgtaactgga
catccacgtcccagggtgatgtggttgatcaatggtcacactgttgtgcatggctctcgc
tacaagctgacaaatgatggcatgttccatctggatgttccaaagacacgtcagtatgat
accggcaaggtggaagtaattgcccgcaattctgtgggtgaatctattgccaccaccgag
ctgaaggtggttgcccgttccgacgattaccgtaatgttctgaagaactctccacgcccc
tggtacgactacgaactagccgcctatcagaaggagcgtcaggaaaacgaactggagaag
gtattcgatgagcgtaagcaggttcagtccgagcagggcgcccataccctgaagggcgtc
gagcatttgaagccaaagcagtacaagccaccgacgccagactggcagcagaacgttaag
gccaagaagagcgaggattattacaacaagctgcaggtcctggagaccgaacaactgctg
aaggagactaacctccgtaaggataatcaccagtacgccattcccggcgagaaggttgtg
agcagctcacagtccaagggcatggcccagtcctacgaagagaatcttcaagagaagacc
agcaccactcaggtgaagcctgccccaccaaagggtaccgccgaaccctccgagtcgtcc
gtccatggccgtgaggtgcacatgaataagcaacaacaggtgcagaaggagatccagggt
gaccttgagatcacacgaaagatcaccgccaccgagaccaccgaggtggagcataagggc
actattcaggagcgcgtggttaagggacccgtcaagccggccaaggctcctgtctttacc
aagaagatccagccttgccgcgtctttgagaatgagcaggccaagttcgaggtggaattc
gatggagagccaaatcccacggttaaatggtaccgcgagagcttccccattcaaaattcg
ccggatctgcaaatccacaccttcagtggcaagtcgattttgatcatccgccaggtgttt
gtcgaagattcggcagtattctcctgcgtggccgagaaccgaggaggcaccgccaagtgt
agtgccaatctggtggtcgaggaacgtcgtcgtgccggcaagggaggcattcagccccct
agcttcgttagcaccattcagagcaccaccgtggccaccggacagttggcccgcttcgat
gccaaggtcactggcacccggcccttcgacgtctactggctgaagaacggcatgaagatc
cagccgagcatcaagttcaagatgctggaggaagatggcgtgcacacgctgctcattatc
gagcccttcgctgaggattctggtcgttacgagtgtgtggctgtcaatgccgctggcgag
gctcgctgcgatggcgattgtattgttcaatcacccagcaagccggacaagcccaccact
ccgggcagtgagaaggccccccatattgtggagcagctaaagagccaatcggtggaggag
ggtagcaaggtcatcttccgttgccgcgtcgacggcaagcccactcccaccgcccgctgg
atgcgcggcgagaactttgtgaagccttcgcgctacttccagatgagtcgccaaggcgag
tactatcagctgatcatctcagaggctttccccgaggacgagggcacctacaagtgcgtt
gccgagaacaagctgggcagcatccagaccagcgcccagctgaaggtccgccctattgag
aacctggacgccccgcctaccatcaccgccctcaaggatgtctccgtcaccgagggcatg
cccgcccagttcaagacgacggtgactggcaaggtgaaggccaccagtgtgcagtggttc
cgcgagggtcagctgattcccgagacacccgatttccagatgatcttcgatggcaatagt
gctgtgcttctgattggtaccacctacgaggaggattcgggcatctttactgtacgcgtg
acgtcgtccaccggccaggtcgagtcctcagccaaactgactgttaaaaaacgacgcatc
tcggcctttcaattgagaacgattgattccgccgaggatgagtcctcttcatctggccgt
gaagacagtgcccccgagtcgccccatgctttccaacctggccagcaacccggccagcag
tttggtcaattcctgggcgtcaacgggcaggttcagcatcagggtaggtcacgcaataag
aaacccaaagttcgcagcaagtcactgcagccacccaccaatatcataccatggcgcaaa
tcatcacgtcccaatcgtggacgctctctggacaagggagtgttcctgccaggctttaag
cctgagccggtcaagtcttggaccgaggagaccatcagcttaaaggctacacccattgag
aagaagaaaccaacacccaagttagaggcagctacggttgtcctcaagtccattaaaact
gaacgggatcagggcattatgagcttgggcgctactctagagcagatcattgctggcaag
accgagaaggaggcggttccttggatcacaatgcgtgaaaagctaaaggcagtggagagt
gtgcagcaacaattaaacaaattcgatttggacgaggtctatctgcgtcccctcgagggt
caaattgaaacggacgagcagttgccacaacaggcccaagtggagcaggttcagcgcacc
aaggagatccaacgactgaagagcatggagagtgtcgagattatggagatgaccgaccag
atcgagaagctcattacacagcagcaaaacaataaggatcgtataccttggaaggagatg
cgtcagcagctcaagagtgtgcagagggtgaccaagcagattgacaagttcaagatcgaa
gaagtagagctgcgccatttgcaggctcagcaggccatcgccgaagagttccaaatggga
acagccgatgagaccgtcataatgactattgatgagagctcaaagggttcgatctccaag
gtgatgcgacgcgatgagctgcagcagtacgaggatcaatccaatctctacaagcagcag
ttcatcaccaccgaggatgtgaatataatgcatgtctcggaacgcgagaaactggaggcc
cagagactgctacgtgaacaacaggcggtcaactggcgccaacagcagcagcgaccacaa
ctgcagcccctaacctcagttgaggataccatagtctcacagaccacagaaagacagaaa
ttgatccagcagcagagcctcatcgaggaagctcagcgccagcagtttgtccaagtcgaa
gactcacagatgatgagtctggagcaatacgagcaccaaaagatgatcaatcagagcacc
cagcacgaggcctttaactggcgtcagccgagagagcctcaaaagttcgttcaggttgaa
gactcttcattgcttcatctgcaggagcgccaggatacgcaacagcagcagctgctgcag
caagaaggtgtcatgtgggagcgcggtaggaagaagccggagcagcctcaaaccttccaa
ccccaaccggcgcctgctcaggaagaatatgtggataagccaaggacatatgaggaaatg
cacgacgagctggtggagcccgtgccggttcaacaaccccaacaggttcccgtcatgtgg
gagaggggaaagaagaagccacagccacagcctcagccgcaaacatacgaagaggcacac
gacgagctggttgaacccactcctgttcaacaacccgaacaggtgccagtcatgtgggag
cgcggcaagaagaaggtggttcaggagcagtccatcacatcacaggaagtggtgctaagc
tcccaaatccttgaacaacaaatcgttgaggagaccaaaaagacagctgttcgccgggtg
attcccccaagggagccggaacagaaggtggagcaagtttctttgaagccaacgccgcga
caacgtcccaaagaagtgcaaaaggctgaggaattccaactgaagccactgaagaccacc
agaaccgttcaggaagccgttgaacagacggccttgaaaacttacgaagaagccaccgat
gaactggctgaagaaactgtaccgcaggtgcaggaacaaccacaacctgtcctgtgggaa
cgtggcaagaagaagccccaacagcccgagcaacaagttcctgagattcccaagacgctc
gaggttgctgttgataccttagaagaggatgtacctaaagtaactgagccacaaccgcaa
cctgttttgtgggagcgtggcaagaagaagaagccagagcagcaagttgttgaggaagcg
cccaaaactcttgaggttgctcaggacactctggaggaggaggtagccaagcccgaggag
cctcaaccacagcctgttatgtgggagcgtggtaagaagaagccgcagccacaacaggtt
gttgaagagaagatcgaagaggcgcccacaaagacctacgaagaagcggtcgatgtgctg
cccgaagacacaaaggtggaggagaagccagagcctgtcttatggcaacgtggcaagaag
aaggctcaaaaaccggaacccgtagaagaagtgcaccccgatgaggtcgatgcgcaaatc
gagagagttgtggaagaagagcaggtcattgtcgaagaaaagcgtagaatcaagaagacc
aagaaaccgaagccaacgaaaactccttccgaagaggtggttgaagatcaaccagaagaa
gaggaagtgcctcaggaagaaattgttgaagaacaggtggaaatcgttgatgaaaagcgt
aaggttaagaaaacaaagaagccaaaaccaactacgcaagtaaccgaggaggaacaaccc
gaagaagaggtgattgaagagcaagaagaaataatcgaagatcagcaagaaattgttgaa
gaaaaacgcaaggtcaaaaaggttnaaaagccaaaggccattgtcgaaaagactgagatg
gaggaagaacagccagaagaggaaattcctgaagaagaggttattgaagagctggaaaca
attgtggaagaagaacaagccgtcgttgaagagaagaaaaaggtcaagaaggttaagaag
cccaaaccaactgttgaaaagactgaagtcgaggaacttgaacagcctgaagaggaggtg
ccagaagagcaagttgaagttattgaagaacaagaagaagtcgttgaagaaaagcgcaag
gtgaaaaagataaagaagcccaagaagattgtggaggaagaccaaccggaagaggaggtt
cagcaagaagaagtcgtcgaagaacaggaagaggttattgaggagaagcgcaaggtgaag
aaggtaaagaagcctaagaaaaaggttgaagatgaggccgaagagcaacccgaagaaatt
gaagagccgcaaatcgaggaggttgaagaaattcaagaatctgttcccgaagaacagaag
aagcctaagcctgctccacaagcccaggaggttgagcaagtcgaaaaggttacgctcaag
cctgctccaaggaaacaacggcctctgcccgagaaggaacaactggaagaggtctctttg
aagccattgaagaagactgccctcgtctcggaaacaactcagcccgaaacaccagagact
gaatttgaggttaaggagcaagtcattaccactgttgaccaaatagtcgatgtgacaaag
aaacgtgttaagaagaagaagcccaagactaagactgacacagaagaggcaatcgaagag
ccagtcgaagatgtcgaagaagaggaagaaatacagccggaagaggagcaacctgtcgaa
gaacctgtggaagaacaacctgaagaagaaacgacaccagaacaaaaagttcctgccaag
ccaaagccacagaaacaggaaattattgaaaaggttgaagaggttgccctcaaacgggtt
accaggccaaagaagcagcttcccgaagaggcgaccatcgaggaagtgcgcctgaagcca
actcaacgtacctccatcaaacccgaggaggtaacgctggaggctgtcgacctgcagcac
gtcgagaaaacagagcaagaaatcgtgcaagaggagaagcgtaaggtcaagaaggtcaag
aagccaaaacacgaggatttgcccgaaattccggatgctgagcccaccaaactggaagag
gcagagcacatcgacatcgttaaggagccaaagccagaggaagagcaaccacaatttccg
tggaaacgaggagaaaagaagaagccggttgaggatgttttagaggaaaagcaatggccg
acaggaaaacgtcgtccattggccgcagaacagccacaggaagttcagcttaagccgatt
ccatcaaaaccgctagaagaaccgcagaagccagaaaaggctataccaggtccacaactt
gtgcctgaagaaaagccagaaagcgaagatgaggagcttgagcttgaaccccttcagctg
cccgaggacaaacagcctaaggaacctaaggcgaagaaggagaagaagaagaagcccaag
ctgaagaaggccacaccttccgtggatgaggtgtcagaagaagtggccgagccatttgat
gagcctatcgcagaggaagatgaagtggaagtgctgcccgtggacgacgataaggtggtg
gcagtttcagaaaatgtgctgccggaagaagaagttgtgaccaccgaagagacgcctgag
gctaaacagaaggcacacaaaaagcgcacaaaacgccttaaacaggcctctgtcgaagga
cagccccaactgctggaagctgcaattgctgaaatcgaaaaggtggacgaaatatcccag
gagatctcacaaaagactattaccctactcaagaagactgaagacacaagacctcaattc
atcacgactgaacagctcatcgagctggatgttgaggacgtccgacgtgatctcgagatg
aaggtcacctcgaatatcatcaagaaggagaagcgtcgcgtggtgctggacgacagccag
ccgctgcctgagctggaactgattacgcagaagcgtatccaggagggcatcgataaggtg
gccgatgaggagctcatcgaggaccagcagctcatacaaaaccagcaggagacgaccacc
tccgaagtgatcggtcaggaacgcaagttggtcaagaagaagaaaaaggagatcaagcca
ccgaggattaccgagaagcttcgtccccgtcagtgtgtacccgaggagcctacggtgctc
gaatgcaaggtggagggtgttcctttccccgaaatcaactggtacttcaatgacatcctg
ctgttcgcatcagagaagtacgagatcacagtcgtcgagcaggtggccaagctgaagatt
gccaaggtcacacccagcgatgtcggcgtctacacatgtgaggccaagaatgaggctgga
gtggcaacaagtcgtaccaacataattttagaaaaagaacaaggagttgccccacagttt
accaaaccacttaagattgagttcactgaggagaagcagcccgagcggctcaaggtaacg
gtaacctgtcaagtgacaggcaaaccaaatcctcaggttaaatggtacagaggtatagag
gaagtcatccccagcgagaccgtgcaaatgttctacgatgaaaagaccggcgatgtggct
ctggaggtgattaatcccactccaaacgaggcagttgtgtactccgtgcaggctcagaat
caatttggtcgcgctattggcaacgctaatatcatgagtcgcgttgatgaagtgcccaag
gaaatactaaaggcacccactgtgactccactgaacgcagtagttgtacccactggcggt
acattgttatttgaggccaagtacgatggcctgcccaggccagagatcaaatggatgcgc
aatggacgtgaggttatcgagaatgaggagatcatcatagagaccaccgagacgacaacc
acaattaaggttattaacatgacgcgcaagcgcactggcaaatatgaggtctgggccaag
aacaaggtgggagaagctaagtcatctggatccgttgtggtctcagatcagaagcccgat
gagcaaattaagccgccaagatttattcaacccctggaacccaagtactttggcgaacac
gaagtggccattattgaggctgttgtagaatctgagccattatcgtccttccagtggttt
gtgcacaatgagcccatcaagagctccaacgaagtgcgcattgtgagccaggccaacaag
tcaacgttgctgattgaggacttccaaaagaaattcaccgggcccttcacttgccgggcc
gagaacgttggtggttcggttacttcaacagccaccgtcaacctaattgaatccctgcca
caggaggaggcagtagagtttgaatcgccgcgattcatcgaagaacttataaagcccgtc
gaggtaatggatggcgaagcattgctgctgacctgccaagttactggcaagcccacaccc
aaagtggagtggtatcataatgaggagaagatcgtcgagaacaaggaaactacgatatcg
caagacttgcaaggcaattgccagctgcagattacggaagtgttccccgaaaacgagggc
caatacgagtgcgtggccacgaacaagattggcaagagtgtgaccaagacaaacgttaaa
attcaagcatttgaatatatccccgattctgaaatcactggactcacaggatctgaggag
gatctacttgatagaaccctctcaatcgacgaacaagcaccgaaaattattaaaaagcta
ccagagaaaatcgagcccaaagagggtgagcaagcgaagctggaggttaaggtcattgga
aaaccaaaaccgaaggtcaaatggctgcgcgacgacgagcagatattcgcttccgaggaa
tatcaaatcgaaaatttcgacgacggcacctcagtgttggtcattaatcacgtctatccc
gatgatttgggtacaattagttttgaggcgtacaatccactgggtgtggcagtaacaacg
gcactctttgcggtcgaaggcatcgttggatcgaaggattaccgcaagccggaatgggtg
actcacatggaggaaatgcaagtggcgctcaaagatacagaacaaaccacagacacaaca
cacacaaaacaaaagacaccaacacaaaaacaagaaactcgtgaaaccgaaatcacagaa
gtcccagaaagcgttcgtgtcgtcgagaccatttccgaagatggcaaacctaagaagaaa
aagatccgcactcgcgttattaagaaggtaaagggagacaagcaagaggtcaccaagatc
gaaaccgtcgaggaagatgacaagcagcccgaaacatcagtcactgtcgaagaaatgcct
gtggaggatgaacagcccgaggaaatcaaggaacttccagaagaggttcgtgtcttcgag
accatttccgaagatggcaaacctaagaagaagaagatccgcactcgcgttattaagaag
gtcaagggagacaagcaagaggttaccaagatcgaaatagtccaagaagatgacaagcag
cccgaaacaacagtcactgtcgaagaaatgcctgtggaggaagaacaaccagaggaaatt
aaggaacttccagaggaggttcgtgtcgtcgagaccatttccgaagatggcaagcccaag
aagaaaaagatccgcacacgcgttattaagaaggtcaagggagacaagcaagaggtcacc
aagatcgaaaccgtccaagaagatgacaggcagcccgaaacaacagtcactgtcgaagaa
atgcctgtggaggaagaacagccagaggaaattaaggaacttccagaggaggttcgtgtc
gtcgagaccatttccgaagatggcaagcccaagaagaaaaagatccgcacacgcgttatt
aagaaggtcaagggagacaagcaagaggtcaccaaaatcgaaatagtccaagaagatgac
aagcagcccgaaacaacagtcactgtcgaagaaatgcctgtggaggaagaacagccagag
gaaattaaggaacttccagaggaggttcgtgtcgtcgagaccatttccgaagatggcaag
cctaagaagaaaaagatccgcactcgcgttattaagaaggtcaagggagacaagcaagag
gtcaccaagattgaaaccgtcgaggaagatgacaggcagcccgaaacaacagtcactgtc
gaagaaatgcctgtggaggaagaacagccagaggaaatccaggaacttccagaggaggtt
cgtgtcgtcgagaccatttccgaagatggcaagcccaagaagaaaaagatccgcacacgc
gttattaagaaggtcaagggagacaagcaagaggtcaccaagatcgaaatagtccaagaa
gatgacaagctgcccgaaacaacagtcactgtcgaagaaatgcctgtggaggaagaacaa
ccagaggaaattaaggaacttccagaggaggttcgtgtcgtcgagaccatttccgaagat
ggcaagcctaagaagaaaaagatccgcactcgcgttattaagaaggtcaagggagacaag
caagaggtcaccaagattgaaaccgtcgaggaagatgacaggcagcccgaaacaacagtc
actgtcgaagaaatgcctgtggaggaagaacagccagaggaaatccaggaacttccagag
gaggttcgtgtcgtcgagaccatttccgaagatggcaagcccaagaagaaaaagatccgc
acacgcgttattaagaaggtcaagggagacaagcaagaggtcaccaagatcgaaatagtc
caagaagatgacaagctgcccgaaacaacagtcactgtcgaagaaatgcctgtggaggaa
gaacaaccagaggaaattaaggaacttccagaggaggttcgtgtcgtcgagaccatttcc
gaagatggcaagcctaagaagaaaaagatccgcactcgcgttattaagaaggtcaaggga
gacaagcaagaggtcaccaagatcgaaaccgtcgaggaagatgacaagcagcccgaaaca
acagtcactgtcgaagaaattcctgtagaagaacagcctgaagaaatccaggaacttcca
gaggaggttcgtgtcgtcgagaccatttccgaagatggcaagcctaaaaagaaaaagatc
cgcactcgcgtcattaagaaggtcaagggagacaagcaagaagtcaccaagatcgaaact
gtcgaggaagatgacaagcagcccaaaacaacagtcactgtcgaagaaattcctgtagaa
gaacagcctgaagaaatccaggaacttccagaggaggttcgtgtcatcgagaccatttcc
gaagatggcaagcctaagaagaaaaagatccgcactcgcgttattaagaaggtcaaggga
gacaagcaagaggtcaccaagatcgaaaccgtcgaggaagatgacaagcagcccgaaaca
acagtcactgtcgaagaaattcctgtagaagaacagcctgaagaaatccaggaacttcca
gaggaggttcgtgtcgtcgagaccatttccgaagatggcaagcctaaaaagaaaaagatc
cgcactcgcgtcattaagaaggtcaagggagacaagcaagaagtcaccaagatcgaaact
gtcgaggaagatgacaagcagcccaaaacaacagtcactgtcgaagaaattcctgtagaa
gaacagcctgaagaaatccaggaacttccagaggaggttcgtgtcgtcgagaccatttcc
gaagatggcaagcctaaaaagaaaaagatccgcactcgcgtcattaagaaggtcaaggga
gacaagcaagaagtcaccaagatcgaaactgtcgaggaagatgacaagcagcccaaaaca
acagtcactgtcgaagaaattcctgtagaagaacagcctgaagaaatccaggaacttcca
gaggaggttcgtgtcgtcgagaccatttccgaagatggcaagcctaaaaagaaaaagatc
cgcactcgcgtcattaagaaggtcaagggagacaagcaagaagtcaccaagatcgaaact
gtcgaggaagatgacaagcagcccgaaacaacagtcactgtcgaagaaattcctgtagaa
gaacagcctgaagaaatccaggaacttccagaggaggttcgtgtcgtcgagaccatttcc
gaagatggcaagcctaagaagaaaaagatccgcactcgcgtcattaagaaggtcaaggga
gacaagcaagaagtcaccaagatcgaaactgtcgaggaagatgacaagcagcccgaaaca
acagtcactgtcgaagaagtacctctagtagaacagcctgaagaaatccaggaacttcca
gaggaggttcgtgtcgtcgagaccatttctgaagatggcaagcctaagaagaaaaagatc
cgcactcgcgttattaagaagatcaagggagacaagcaagaggtcaccaagatcgaaacc
gtcgaggaagatgacaggcagcccgaaacaacagtcactgtcgaagaaatgcctgtggag
gaagaacagcacgaggaaatcaaggaacttccagaagaggttcgtgtcgtcgagaccatt
tccgaagatggcaagcctaagaagaaaaagatccgcactcgcgtcattaagaaggtcaag
ggagacaagcaagaagtcaccaagatcgaaactgtcgaggaagatgacaagcaacccgaa
acaacagtcactgtcgaagaaatgcctgttgagaaagaacagcctgaagaaatccaggaa
cttccagaggaggtgcgtgtcgtcgagaccatttctgaagatggcaagcctaagaagaag
aagatccgcactcgcgtcattaagaaggtcaagggagacaagcaagaagtcaccaagatc
gaaactgtcgaggaagatgacaagcaacccgaaacaacagtcactgtcgaagaagtacct
ctagaagaacagcctgaagaaatccaggaacttccagaggaggttcgtgtcgtcgagacc
atttccgaaaatggcaagcctaagaagaaaaagatccgcactcgcgtcattaagaaggtc
aagggagacaagcaagaagtcaccaagatcgaaactgtcgaggaagatgacaagcagccc
gaaacaacagtcactgtcgaagaagtacctctagtagaacagcctgaagaaatccaggaa
cttccagaggaggttcgtgtcgtcgagaccatttctgaagatggcaagcctaagaagaaa
aagatccgcactcgcgttattaagaagatcaagggagacaagcaagaggtcaccaagatc
gaaaccgtcgaggaagatgacaggcagcccgaaacaacagtcactgtcgaagaaatgcct
gtggaggaagaacagcacgaggaaatcaaggaacttccagaagaggttcgtgtcgtcgag
accatttccgaagatggcaagcctaagaagaaaaagatccgcactcgcgtcattaagaag
gtcaagggagacaagcaagaagtcaccaagatcgaaactgtcgaggaagatgacaagcaa
cccgaaacaacagtcactgtcgaagaaatgcctgtggagaaagaacagcctgaagaaatc
caggaacttccagaggaggtgcgtgtcgtcgagaccatttctgaagatggcaagcctaag
aagaagaagatccgcactcgcgtcattaagaaggtcaagggagacaagcaagaagtcacc
aagatcgaaactgtcgaggaagatgacaagcaacccgaaacaacagtcactgtcgaagaa
gtacctctagaagaacagcctgaagaaatccaggaacttccagaggaggttcgtgtcgtc
gagaccatttccgaagatggcaagcctaagaagaagaagatccgcactcgcgtcattaag
aaggtcaagggagacaagcaagaagtcaccaagatcgaaactgtcgaggaagatgacaag
caacccgaaacaacagtcactgtcgaagaactacctctagaagaacagcctgaagaaatc
caggaacttccagagttggttcgtgtcgtcgagaccatttccgaagatggcaagcctaaa
aagaagaagatccgcactcgcgttattaagaaggtcaagggagacaagcaagaggtcacc
aagatcgaaaccgtcgaggaagatgacaagcaacccgaaacaacagtcactgtcgaagaa
gtgcctctagaagaacagcctgaagaaatccaggaacttccagaggaggtttgtgtcgtc
gagaccatttccgaagatggcaagcctaagaagaaaaagatccgcactcgcgttattaag
aaggtcaagggagacaagcaagaggtcaccaagatcgaaaccgtcgaggaagatgacaag
cagcccgaaacaacagtcactgtcgaagaaacacctctagaaaaacagcctgaagaaatc
caggaacttccagaggaggttcgtgtcatcgagaccatttccgaagatggcaagcctaag
aagaaaaagatccgcactcgcgttattaagaaggtcaagggagacaagcaagaggtcacc
aagattgaaaccgtcgaggaagatgacaagcagcccgaaacaacagtcactgtcgaagaa
attcctgtagaagaacagcctgaagaaatccaggaacttccagaggaggttcgtgtcgtc
gagaccatttccgaagatggcaagcctaagaagaaaaagatccgcactcgcgttattaag
aaggtcaagggagacaagcaagaggtcaccaagatcgaaactgtcgaggaagatgacaag
caacccgaaacaacagtcactgtcgaagaagtacctctagaagaacagcctgaagaaatc
caggaacttccagaagaggttcgtgtcgtcgagaccatttccgaagatggcaagcctaag
aagaagaagatccgcactcgcgttattaagaaggtcaagggagacaagcaagaggtcacc
aagatcgaaaccgtcgaggaagatgacaagcagcccgaaacaacagttactgtcgaagaa
atccctgtggaggaagaacagcccgaggaaatcaaggaacttccagaagaggttcgtgtc
gtggagaccatttccgaagatggcaagcctaagaagaagaagattcgcactcgcgttatt
aagaaggtcaagggagacaagcaagaggtcaccaagatcgaaaccgtcgaggaagatgac
aagcagcccgaaacaacagtcactgtcgaagaagtacctctagaagaacagcctgaagaa
atccaggaacttccagaagaggttcgtgtcgtcgagaccatttccgaagatggcaagcct
aagaagaagaagatccgcactcgcgttattaagaaggtcaagggagacaagcaagaggtc
accaagatcgaaaccgtcgaggaagatgacaagctacccgaaacaacaaaaccagaaaca
attgttacggttgaagaaaccgataatagatctccaagtgttggaaaaactaagttgaag
aaaagagttattgtccaaaaaccggaggatgaagtgactgtttttgaattgcctgagcgg
aaatcagttatactttcagaaaaagaagatggtactccaactaaaacagttattaaaact
aaaatcattaaaaagattcagggtccgcatatggaagttactaaagtccaaaccgttgag
gaatatgaaaaaacacctcagacgaaagttacggttgaaaagtttgaattacccttccca
gaactgccagaagaaaaaatttctgaagttattgttttgccagatgaggtttctgaattt
gaaacaattgatgaagaaggacatccaaagattgttaagaccaagaaacgtgttattaaa
aaaccagcatttggcaataacgaagaggtaactgaaatcggaattattgaacaagataat
actgaacctttatattcagtaacaattaaagagcaacccataacctattcccaaccggat
gacagtaaattagttgagctacccgaacaagtgacagagatggagattacttcacctgat
ggaacaaaaaagaaaaagaccgttaaatctagagctttcaagaagagcatcgacgacaaa
cgtgatgaagttacaactgttaatataatagaagaggaagataaggagccactgactaca
gtgcaaatagaagttgtgccatctgatgaggtatccattacacccataccgattgaggaa
cttcctgaggaaactgttttcaccgaagaactagacgacaataagaagccaagaaagaag
actacaaaaactagaacatttaaaaagcaaggacctgcggacgaggaatatttccaaatt
caaactattgaagaagaaggcaaggaaccgtacgctctaattcgagttgtcagcgatgaa
aacattgctgatattatagatattagtaaactcgacgatgaaaaggtttccaaacacaaa
caaaaaccacacaagcataaggtggagaaaccaaagatcgataacacagaaacggaacac
ccagtttacataacaacatttaaatctgtacaaaatgatgacggagaaacaacaatacaa
agtgaaaacaaacgagtatctcaggaggaaggcatccttgttgaggaagtccttagtgat
acagaacccattccagaagacactacacaatcacaccttgaaattattgaagtcaacgag
ccatcagaccaatacaacaaagagtacactatcactgaacctgaagaggcaagtgcagac
gtgaaacaaacaccggttaaagacaaanaacccaaacagaaaaagacactagaaacacca
attgaggaagttgacgagactgttattgaagaacaaagtacagaggaaccgactgacaag
acaattaagaagcgaaagtctaagaaattagtaggtaaggttgaggagacttctgctgat
gaaaagccagttgaagagaagggaaagccgaggaaaaagaaggtggttaagtcgaaacga
gatgagttggatgaatacattcaattcctcatacaccaggaaattccaaagactgttctt
caagaatacaaacgtacagatatggaacatcctcaaagggcacgtcgtgattcttccttt
aaacagccagttaagcttactccaatgaaaatcgaaagagtcgagtttagaaaacctgaa
aaggttgaaataagttctgtggaagaatttcctcaaatgcttaagttaaaggcacctaaa
caacgaccccaagaagagaaaaagaagaaaaatgaagcatctttcnaaaacaagaaatta
aaaagctggataagatttattccatacgcaccatattgtttcccatacgtggttaccgaa
ttggaaaatacctgcgatcatggggaactttcccgtaatgttaaagaagctgaggaggtt
ttgaagttccgaccgaaaaaattcaagcacacgaaacctgaaaaggcagaactggagcaa
tcagatctgccaacattagactctgaaaaggcagaaccgtcagataaggagcaaccaaag
ccaaagtatcagcgtggcaaaaagactgagaaggaaacaactgaggaaagtcgaaaaatt
aagcttggtaagggcaagcttcccgaaaatgttgaatcagttgaggaagttaatttgaaa
ccggtcaaaaaagatatcaaggaagacgatgtcagtgaagagccagttaaggttgcagaa
gaagaggtagtcaagaaaaagaaaaccaaaaaacccgataagtctggcgaaggtcttcaa
ttccagcctaccgagttcaaggatattgaaagtacttttgaattcccagaagagtcggac
gaatcgctaggcgaagagatgcacaccgacgacaaaccaaagtataagaggaagaagaaa
ccgataccaactccagagcaagacaagtacgaaatatctcctgggaaaccgagagaactt
gaagaagtcccggaagaaggccttaaactgcgcaaaaaacaaggtcaaaagccggttgac
gagaaggaaggacttaaacttaaaccattttataagcttgaagtgattgaattggaacca
gaaaatgccacagatgaagaactgccaataactggtaaactaacaaaagaaccaaaaaag
aaacgtaagctcaggcttaagactgaacaagaagacaatacaattgatatagttgaagta
tccccgaagngcacagatgacaaaatttacgaagttaccatcacaagttcagaaatagtt
caagacgacaaaaaagaaagcaatgtccgaaagaagaaggtcaagcggatgaacaaaacc
gaattggacgattttgtctcagagttacaagaagagcctgaccagaagttctatgaaaca
acaacacatgatttctatgaagttaaattgaccgagctggagccagaaaacgattctggt
gtagatgatcaacaggaaatagaaaaacccaagaagcgcaggattcgacatgaaaaggga
gacgaagtggaaattttggaaattgtcgaaactgtggccgctcctggcgaagagccactc
tatgaaattacaattacttcgagtgatagtaagacagaagagttcggtacacagccggtt
gaaaagccaaaaaagagaacaaagaaaatgaaaaaggatgaacttgatgcatatattcag
caactaattaatgctgaaattcctataacagaattggaaaaatatgagaaaatcgatgtg
gatggcaagccgaagaaacccaagaagcagaaggtcaaacatgagaagtcaatcattgat
gaaggcgagacccttcaggtcggtgtcaccgagcacgagccagttgagaaaccaaagccc
aagaaacaaaaaccaaagaaagtcacgaaagtggaagaaaccgttgagtcggaggaagtt
ccagtatacgatgagtaccttattaaaaagattgacgcagagcgatctccagagcaagat
attgaaaaaccagaggaagaaatcctaacagctttggatgaaataataacagagttgact
gaaactatgcctataatcgtagtggaggaagactttgtgtcagtttcattgccttccgaa
gttgttcatgatacggatcagaagataattaaaaagcgcaaagtaaaaactagaaagggc
tcgaaacactacgaaatcgaaataattgaaactgaagcatcaaatgacaagcctgaggaa
gcagaggttatagtaataacaactgagatttccgaagataccacagatgggcctgctatg
gttaaaccagaagcacccaaaaaattagttaaaaaggtgaaaaaggagaaacttaaggag
ttcattgtaaatgttgttgaggaagctcctttggaacacttagttgaaatatctgaggat
ttgacaattactcctgaaaaagaagattcagtggaacaagatatcatagcttttaccacc
acagtagttgacgaggagacagttccagatgttataccggatcatagtaaacctgaagaa
gctgtgagcttgccgaaggataagaaaaagaaaactgataaacagaaaaaggttaaagta
tccgaaacagaacctgtgtctactacagatgactcgaagattgcagaacatactgctgta
atttcccaatcccatgattctcctcaagctgatgaatatttggttgatgtgaaagatact
ttacctaagggcaaaaagaaatccgtgaagaaacctaaagagaagtccttcgacgagccc
atctccgaatatacgattcgtattgaagagctggcaccagaaaccgttgtagaaaaagtc
aatgaagagggagcggaagtggaacgtgtcattaccaagcgtaaactcaaaaagaaggat
ggaccgaaagaatatcttattgaagtggttgaaacatatgaagaaaacaaacccgaatcg
gatattgttatccagaccattgacataactcctgaaaccgacaccaaacctcaggaagag
cataagataaagattgtgaagaagaggaagcctaagaccgaaagcttagatgactttatt
cacgagctcattgaacaggatattccaaaaacagatcttgaagagtacgaagcaccagta
accgagacttctccggaggcaaagaagcctacaaaaattaagaaacaccacaaaaaaact
accgagatcatcgatggcgttccaattacagtctacgagataagcgtacaagagtttgaa
tctgaacaagatgatgttaagccagacgaagtcgctttagtagaaactgaaagtggggat
acagcagaaccttatgaagatttggaagttaaggttctagaaagcaagcccaagtcaaaa
tcaaagaaatcgtttaagacgaaggtcgttgaggatgtgcagccccaaccaattctagag
gatattgaagagtctgtggaaatcgtacaagttactgaagaagatggagtaccaaagcag
gttgaagttaagaaaaagaaggttttgcgaaaacagggcccaaaagaacaaatcttcgaa
gtcacggaaactaaaactagtgatgagcctctggctgaggttactattgttgagttaact
gaaaaacaacagcctaaggaagacgttgttcaacccaaagaaaagaaaccaattaagaaa
ccgaaaaagctgaagcctgaagatgtcaaaaactatgtggttaatgttcttgatgagttg
atcgagccttataaatttgaagataccgagcaaccagtcattactgaaattgcagagtcc
gtggaagtagtacaagttactgaagaggatggagtaccaaagcaggttgaagtaaagaaa
aagaaggtttcacgaaaacaaggaccaattgaacaaatctttgaaatcacggaaactaaa
actagtgatgaacctttggctgaggtaactattgttgaagtaacagaagatcagcctaag
gaagacgttgttcaacccaaagaaaagaaaccaattaaaaaaccgaaaaaactgaagccc
gaagatgtccaggactatgtcgttaaggttcttgaagaatttgtcgagccttacaaattc
gaagaaccagtcattacagagattgcagagtctgtcgaaatcgtacaagttactgaagaa
gatggagtaccaaagcaggttgaagtaaagaaaaagaaggtttcacgaaaacaaggacca
attgaacaaatctttgaaatcacggaaactaaaactagtgatgaacctttggctgaggta
actattgttgaagtaacagaagatcagcctaaggaagacgttgttcaacccaaagaaaag
aaaccaattaaaaaaccgaaaaaactgaagccagaagatgtccaggactatgtcgttaag
gttcttgaagaatttgtcgagccttacaagttcgaagaaccagtcattacagagattgca
gactctgagcaagaagagcaggcactcagtaagcccaaaaagtctactaaaaagccagtt
gaaaaaacagtccttattgaagaaatggctccagaaaccattattgaagacatcgttaac
gacgagggagaagaagtcaaacagatcaagacaaccaaaaagcttaaaaagaaggaagga
tccaaggaatatgtcatcgaagtaaccgaaacttatcaagaaaacaagccagaggctgag
atcgagtttactacaatagagatacccacggaggactcaccacagattacagaagaccaa
ccagccaaggttgttcagaaggttaagaagaagaagcctgtgaaggacgatcttgacaaa
tacatacagcagttaatcgaacaagaaattacaaaaaccactcttgaacaatatgagcca
acagaaatggatgcaaaacccaaacaacccaaaaagaaggttaaaactcaccacaaaaag
actgttgaagacgtcgatggcttacctgtcacaattcacgagttcaatgttgaaatcgaa
cctgttagtgaagatctaaaaccgttggaaattttgccagaggacatcgaagagacaccc
cagaagccagacgactcatccaattatattgtaaacatttccgatgaatttgttgaatct
gatcagcctactgaaaaatctccggaggaagaacaaaaaccaaccaaaaaagaaaaatcg
ttgaaaaagaagaagttgactgaggttcccgttcccttaacagaaattgaacaaactgtt
gaagtcgttgaacaacccactgaggaaggagaggtcaaagaaattactgtgaaaaagcga
aaggtttcacggaggaagggatccaaagaacatgtttttgaaataactgaaactacaagc
gatgatcagccaatagctgaagttacagttgttgaactaacttctgatgatgtccttgtt
tccgaagaaaagccaaagcctgaaaagaagataattaaaaagccgaagcaactgaagatg
gaagaagttgaggactacgtcattaatgttattgaagaattcgtagagcaggttccagtt
gaggtagttgatagtgacgcagtaaaagttgaggaagaagctcctaagaagccaaagaaa
atttctaaaaagtacacagtcactgaacaagaaactcctgaaagcaacgttcctgaaatt
gtcgaagacgctccagtgcagccagttgaagatgtcccacaacaagaaatcgaaaccacc
gacttttcgattggtattaaggaagatactgtagttgacgagaaaaaacaaccaaagtct
aaaaaggtgacaaaaaccaagcaagtacaggaacccgtttcggaagaaaacaaagagtat
ctagttactcttaaatctgaagaaagtgtcagacaagaagaacagccgaaaaatgaaact
gcagttgttgaagttcaagatgataaaccatcggatcaaccttctttccagatagaagaa
attgaaaccgtagcaatagaacaggaagttatcgacgataagggagaaactgcgaagcaa
actgtcaccaaacgtaaaattaagaagcaacttggacccaaggaggaaattattgaaatt
gtggaaactaagactggtgacgaacccgagtatgaagtcattgtaaccacgcaagatgct
gaaatagttgatgaggaagttccccaggaagaaaaaccgaagaagattcgcaaagctaaa
aaagtgccaaaggacgacctccaagactatatccagaagcttattgagcaggatataccg
aaaacagaactggaaaagtatgaaaagatcgacttggatgaaccagtaaaaatgaaaaag
aagcccgtcaagaaggtaaaggtttctgaagaacaaccaacagaagaagctgaagaacag
ctggaagataagccactggaagagaaaactcaagcttctgaggaggaaaatgacgaacca
ttgctaacatttaccgtcaaggaatttattcccgaaaaaccagaagaaactactttcgaa
atagttgtccttgaagaaaccgtagagaccaagcaggtgccagatgaagaggggaaaata
agggaaaaggtggtcaagacaaagaagataaaacagaaaaagggtccagaggaagtggtt
cacgatattgttgaggtaacagataaggatactaacgaatctgaaataacggttataacc
acaagtccaacggaaacgcccgatcaggaggaacccgtagtcaaacaaaagcggactaaa
aaggttaaaaaggacgatgttgaagactacattaaagctgtaatcgaagaggaagctcca
aaaccggcactgccagacgatgtagtagtggtggtagaggattctgcttccaaaccaact
tctgagaagccgaaaaagaaaacaaagaaagagaaacagcctgttcctgaggaagaaaaa
ccaaaggaggatgaaatatctattgttgaaactatcaaagaagatgcaccggttaccgat
gatctaataactatgcaggagtccataccaagtgtggaagaacctgaacttgaaattgat
caagttgaagagattaagaaaccggaaaagaagaagaagccaaaggcaaaggttactgtg
tcagaagaggttccacaagaggtcttggacgaacagccattagaagttaccgaaaaggaa
tccgatattgaaaaaccacaacaacaagaattcaatatttctgtcaaggaagaagataaa
cctgagcctaagccagaaaaaagaagacgccaaagaaaatccngagaagagtcagaccaa
ccgttagaggaaaaatacgaaatttcaatcaaagaaagtgatttggaaccagcaggagaa
aaacctttcacgattgagataattgaaagcgaaactaaagtcgaggaaacaacggacgat
actggggaagttcacaagcaggttaccaccaaacgaaaattgaaacgtcctgatggcgaa
ggagaaatagagattattgaagttgttcgggacgatcagcctgaggcggaaataactatt
gttgaatatgaaccagaacctgtacagcaagaagaaaaacccaaggaacccnaaaagaaa
acaaagaaagtaaagaaagatgacattcacgactacatacaaaagcttattgacatggaa
acgcccaagactgagttggaaaagtatgagaaaattgaattcgaacccatggttaaggac
aagccatctgaacatcaagttgatgttgttgaggaaactccttctgaaaagccgaagaaa
gataaaaagacaaagtccaagccagttccgaacgaagagtcttctgttccagatcaattt
gctgaggtaaaaatagtcgaagaagaagctccggaacaacctttagtaccggttgaagtt
gtcgaaattcaacccgttgaagtagaaattcaggaagtagtttctgaggaaggcaagccc
attcaggagaagaccactaaacgtgttttgaagaaaaagggaccgaaagaagaaaccact
ttcaagattacaaccattgaaaatgaggataccgattcagtcactgttattgttgatgaa
gaaccggatatagttcccatacaggccgtcgaagacaaacctgagcagactgaggagaag
cccaagccaaagccgaagaaaactgttaagaaggttaagaaagatgatctagacgactat
gtaaagaaattaattgaggaggaaattcctaagcccgatttagaaaagtacgaaaaggtt
gaaataccagcagaatctgacaaaccagcttcttctgaagtagctccggcagaggttaaa
ttagatttaacagagccaataccaattgcagacgactcagccaaaccaaagaaaacaaag
actccaaagcataaaacaatagcaactgacgaaacaatacaagacaaaccgacagacaaa
attgttgacattactgacactacagaaatcacaccaaaccaaattgcacaacccgaggac
acagccactgcacaaattacaccaagcgcacaagaagataaacctactcaagatgacact
aaagatactattcagaaaacagttaaacataagaaaacaaaaccagacacacaaaaaagc
gttgaaacaagtgaagtaccagaagttcaaaaagactatcaaataagcatcattcacgaa
gagcccgttgaggaagagcagccgcaaaagattttggaggtgcgagtcatcgatgaagtt
gctgaagtcgaggaatcacagcctattgtcgaagaggttgaagaagatgaggaacagccg
ataacagaggatacccctgaggacgtcacaaagccaaaaactaaaaagaagaaggttgtc
aaaaagaagaccgatgaccacgatgaaatcatcagaaaattgctggagcaagaaatcgag
aagacagaacttgagaagtatgagaaacttgaattcgatcttccgaagaagctcaagcca
gagttcgctagtctagagccaatgaaaatagaacggaaggaacagaaaccgacgaaggtg
acaattgtcgaggctgccgacgttcccaaaactgtgaaacttaagcccggcaaacgtaaa
gagaagcccgccgaagaacaaagtgttcaactgcctaaattccgtctcaaaacacgtatg
gtcatagttgaattcccacctgctccgcttattccgaagcttacgaggattggtgccacc
aaagataatggtgaactatctcgaaacatcgaagaggctgaagaagccctcaagttcaaa
ccacacaagaccaaaaagatcaaaaagatcaaggatgatttagaaaaggttgagcttgaa
aaatacgagaaatatgtcagtagtgaggaagagccagaggaaaaggcaccgtatcagaaa
ccggaaaaggcgcccaagccagaggaaaagcaagaagatgtaaagattaaactgggcaag
ggtaaaaagaaaccaaaggaggatgaagaacctgagaacgttacacttaagaagattcct
atcaagccccaggaagtagaggaagaagttgaattaaaagccaagccaaaggaagtggtt
gttgttgaggagcaagcaaaggagcccaaggaaggacagttcaatgttgagccgttcgaa
cctgtcgaattcgatcgtcctgagtatgaacctgaagagctggagcccattgaacatcca
gatatgccagaaaaaccgaagaaacccttaaagaccaaatataagccaaaggagaaatcg
aagccagagccagaaaccataatctcggagatcgttcctggagtaccaaaggaacaggag
gaaatacctgaagaagaaattaagttccgcaagccagaaagaaaggctccagaagagaca
gactccgaaatcaaactacgaccagttcctaaagcacctcaagcggaagaacctgctgag
gaggccattgtaaggcctaaggtggaagaaccccagcctgaagtgcccgaagttaaatct
gatgacgaagctaagaaaccaaagaaggccaagtccaagaaggtacagccaaaggaagaa
gagttaccagagcaaagaccagaagactatgagatatcggtaaaggaagaagaagctcct
ctaaagaagccagtcgaaattgaacaaccaaaggaagtaaaggtaaaacagaagaagccc
aaagaaacgcctgtatctgaagtggaagtcaccgaagaaataccccaaccagaagaagtg
ccagaagaaataccagtggagtacaagataacaactacggttttggagccagaagaggca
ccgaaggaacatcaagtccgcgttatagattctgatgagcgtcaagaaaccactgaggaa
gttatcgaagaaaaggttgtaacacggaagaagaaaccaaagccacagcaaccagaagag
tttgaagtcactttgaaagagccaaaggaggaagagcagccagttgaggaagtttcggct
gaaatcgttctgccagttgagcagcccgaacaaatgccagaagagtttgaagttgaactt
aaaatgactgagcctactccagaaaagcccgttgaacaggaaattacggtcaaagaaaaa
actaaaaagaagcttgtgaaagaagtcaagggagataagattgtcgtggtggaggaagaa
gaaaagatacaaccagttgaggaacaagtggttgaagtcgaaaaacaagaggaaaagaag
aagaccaagaagcccacgtcatatgaatttagcgtgacagaaaccgaagctatcgaggaa
aaaccagctgaaattgttgaggaaacacctgaggaaactcccatagttttggaagagaag
gttgtggagaagtttgattcatatgaaatcactctcaaggaaagtgaagcagagaaggtg
actgctgtggaagaacagcccgaggaagaaattccccaagaagttgttctcaagaagaaa
ccgaaaaaaccagaagaatttgaggctgaggttgtgttgactgaaccaaaggttacagag
gaaaccaccgtggaaactgaaatcaagcaaaagaaggttaaaaagccaaagaagactgaa
gatgaagctcaattagaaatcaaggttgttgagtccgaagcacctgtttctgaagaagtg
attgtcgaaactgctaagccagagattgtagaaaagcaggaagttgttgtcgaagaaaag
cctgaagaatttagcattcgtgtttcggaaactgaggccaagccagaagaaccaagcgaa
gcacagtttacagtgaaaaaacgcaagccttcagtcacttttgccgacgaaccagcgacc
gaaatcattttgaaggagtccaagcccgttgaagaagttactgaagaagctcaaatcaag
accaagaagcccaagaagaaggttaaggatgtggaggctgaagaattaaagatcacaatt
actgaggagactccacaggaagttccaatagttgaagaagtcgaggaggaagaggtggtc
acggtggtcaaagaagaagtgccgaaggttgaagataaaacctatacttttggcattaag
gagactcagcctgagaaacctgtagaagtgattgcgaaggaagagccggtggtagcagaa
ccgattgtggaagagccgcagcctgaagtttttgaagaacacaaggttaaagtcattgag
gaaactccacgtgaagttgttgaagaagtcgtcgaggaagaagttaaggttattcgcaag
aagaagcctaagcctgaagctaaggatgaacctgaggcggaagtaactgtctcagctcct
aggcccgtcgatgaagtcgaagctacttccagcattacagtggttccagagcagccgacc
gaagaagaagccgctgatctaaaaataacaattattgaagaagtggcgccacctcaagac
cttgtacaagagatagaagaaattgaaatcgtcgagaaaccgaaggcaccggaagagacg
cccgcagactttagctttgccattaaggaagctgaaaaggaaccaaccgtggaagagtta
ccggaggaacaggttacgattcagaaaaagaagaagaaggcgcctgtggctgaggttgta
gaagaacccgaagctgaattcatgatgaagcccaagcagccagtgcaagaagtttccgaa
gaagccaagatcaagaagaagtccaagaaacctgttgcccaagaggaggcagctgcagag
ctgaaggttactatcactgaggatgttcctacggaatctgaagttcaggaaatcattgag
gaaatcgaagaagtaccagaagaaaagcccgctgagtacactattggtgttaaagaaact
gaaccagaagcgccaaaggaagaagaagtcagcttacccaaaaagaaaccaaaggctatt
ccagttgttgaagagcccgaggcagaagttactctgaagccgaaaccaaaggtggaagaa
gttgaggaagaggctaagatagtgaagaagaaaccaaagaaacctgtcgaagaagccgct
gctgaggatcttacagttaaagttgaagaagaagttattcccgagccgattgtagaagaa
gagattatagaggaagtccaaattaagaagaagccagaacctacaccagaggacattgtc
gatgctgcggttgtgaaactaaagaaaccacaaccggaaaaggcagatgaagtggtggct
gaagtaactctgaagcctaaggcaccgaaggaggttcaggaagaggaattctctgtggat
gttaaactgccaaaggaacagaaggtgaccgaggaaacttccgaccaaacagtacagctt
aaaaagaaaaagaagccacaaaaacccgtggaggaggctgctgctgaactggagctaaaa
caaacggttatcgaagaaaggccagttgaaatcgaagaggaagaaatcgttgaagaggca
gtcataattcggaagaaaccaaagaaaccgttcgaaccaactgttgaggatcttgaagaa
actgaattcagtctttcctttaaaaagccacataccatcaatgagggcgtggaagaggct
gccaccgtgctaaagaaacgaccagtaaagcccaccaccatggatgaggccgcggctgaa
ctttctatcaaacgccaacaagaagaatacgaagagggcgaagatatcgaagagtttgtc
gttagccaacgtgccaagccaaagcctctgcagataactgaagaaggtgaagaagcctac
actgttaagaagctgaagaaacgcaagcaggtcgacattcccgaatacgctgacgttgag
aatgtcacgttccgtgccaagactaccaagactaaggaggatgtcgatcaggagttcaac
attgctctagactcgtatgcagaggaggaaatctctatgtctggcaaggttaagcttaag
aaaccgatcaaaaagactttctctgaggcagccgatgaggcccacattaagatcatgcat
gattacgacgatggtgaagagcccatcatcgaggagattcgagacgatgaggataccatc
gatgaagtcgaggagcctgaagagtactttgttgaggaacttccaccagatgatgtcgat
ttcaagctgaagcccaagaagcaacccaagcctacctattccgttcaggatgaggaagaa
gaacagttcctgattggcattcggcatcctaaacgtgattctgtgacctatgatgaggat
tctctaacgttcaagaagaagcgtaaggttgtccaacaacttttcaatgaagatggagca
tcgcttaatatcaccagagaaatgaatgttgaagaatcggaaaatcccaatgttatgtac
tccatttgcaattatattgctgataacgacgaagctataaacttagtggagggtgaaaag
gtaacggtgattggacgtcacagctctgagtggtggtatgtcaagaagagcattaccgaa
gaagaaggctgggttcctgctcaatatcttatggagcccgatgaatacgctcaatatgtg
caaaataagttgcatgagaagatcgataagctgcctgtgtttgaacgtcctggaccagaa
gataagcccattgccccacgatttattgagaaactgcagcccattcacacacctgacggc
tacactgtgcagttcgagtgcaaagttgagggtagcccgaggccacaaattgcctggttc
cgcgagactgccattatcaagccctcacaggacttccaaatattctacgatgacgataat
gtggctaccctgattattcgcgaggtcttccccgaggatgcaggtcagtttacgtgtgtg
gccaagaacgccgctggatttacttccagtaccacggaactgattgtggagagtccactg
tccgatcatggttctgatgcaacagccctatcccgtcgcagcatgtcccgtgaatcttcg
ctggcggatattttggagggaattccaccaacattctccaagaaaccaaaagcccagtac
gtggacgagaatacaaatgtaattctagagtgccgactggtagccgttccagaaccggat
attgtctggacctttaacggtgtagacattgacgaggaagagctcaagaatgttcgcatt
gttaccgaatccgacatgcacatgtattgcagtgtggtgcatatcaccaaggtgaaaaaa
tcgcaagaaggcatttatgaggtgattgctacaaatcgcgaaggtgaagcacgtcttccg
atcacactgaaggtgcgtaccaccgaccaggaggcaccacagatcttggaacccctgcgc
aacatggtcatacgcgaaggtgagagtgttgtgctttccactcagattgtgggaaatcca
ccaccaaaggtaacgtggtacaaggatggcaagcccgtcaagaatgccaagtccgacaag
gatttgcacaccttaacactaatcacgcccaagaagtccgaaaagggtgaatacactgtt
aaggctgtaaatcccttgggaaatgtggagactactgctaatctcacaatcgaagaagct
accagtggtaacgcagagccaccactctttgtggaacgcttcgaggagcaaaatgtgcca
caaaagggagagattcgtttgccagccaaggtttccggcaatcccgttcccgaggttcaa
tggctattcaacaacagtccattgttccccagcgaacgcatccaacaggtatacgatggc
gagaacattgagctcatcattaaggatgccaatccagaaactgattccggcgactacaag
tgcattgccagcaaccccattggtaaaacgtctcacggagcccgtgtgattgtcgaagtc
gatgaggtgaccttcactaagaagcttaagaagaccattaccatcgaggaggttcaatct
ctaaccctggaatgtgagacttcccacgtagtgaccaccaagtggttcttcaatggcaaa
gagctcagcggcatggatcatcgtgttgttgttgaagatggcaagacccacaaattagtg
ataagaaacacgaatcttcgtgattctggcacttatgtctgcaaggttaagaaacaagag
actcagtcaactgtggaggtgctgcaacgcaaacccgattttattaaggtactcgaggac
tacgaggtaaccgaaaaggatacggccattttggatgtagagcttactacagaggcaact
gaggttacctggtttaaggatggcgagaaaatcacgcctgaaaacaagaatgttgagttc
attaaggacggcaaggctcgtcgcctggtcatccgcgataccaccatccatgatgagggt
cagtatacttgtaagatcgaaggacaggagtgcagttgtgagctggttgtcattgagctg
ccaccagagattgttgagccgctaaaggatgtttcggtgactaagggtgaaaatgccaca
ttggaagttgagctcagcaagggcgacgccctggttaaatggtataggaacggcaaggag
attgtgttcaatgaacgcattcagctggccattgatggcaagaagcaatcaattcgcatt
cttaaggccaagccagaggatgttggcgaatactccatccaggttggtgaacaaacctcg
aaggccaaactgactgttgaggagccgttggttaactttgtcgtccccctgccggacgtc
acgctggccacaaagaccacagatgctgagtttacggttgagctgtctcagcccgacgtg
gaagtgacctggtgcaagaagggtaagccaatcaagcccaacaagaagcacgaggtcttc
gttgagggaactgtccgacgattggtcatccacgacgctaatgacgacgatgccggcgag
atcagctgcgtggccgagaatgtcaccagcagtaccaaactgtgcgtggaggagctcaaa
ctgccacccgtcattacctctgacaaggatcagacaatcaaggtaaaggaggacgacgat
gccatcttcactgtcaagtacacaggcgtcccaacacccgaggctatatggactacgcgc
aaggttgtcatacctaagtcaaagcgcacaattccggccatcgatgaacagtctgccacg
ctaaccatcaaaaaggttgtcgacgatgacgagggcgagtacaccgttaagcttgtcaac
ccagttggcgaggcggaggccagcctgcatttggtcattatgcgcaagccgacggcacct
ggtactcctcaaccactggagataatgcacgattccattacgctctactggaaggcgccg
gaggacgatggcaaatcggaaattatcgaatacattctggagtaccacgatgttaaggaa
gaaaaatggactgaaattcgcaagataaaggatactacatacaccatcagcaagctgaag
atcgacacggagtatgtgttccgttcgattgccgtgaatgaggttggaccctcaccgccc
tcaccggcttcgccacccatccgtttggtgcccaaggtcgagacggaggcgccaagcgta
cgcgaacctctgcaagatgtggttagcgaattggacaaggaggttacgctgtcctgcgtg
ttcggcggcattccagagccaaaggtgacgtggaagaagaacggcaaggtgtttgagtcg
agtaaccaacgttacgagaaccgtgtagccaaatacacaattgaaaagacaactattgag
actgaagccacatacacatgtgtggcgaccaacgagaagggcaccgtggagacgtcgtgt
cgcctgaagctgcagcagaagcctgtcctcgaggtagaggataagtatctgacgcagaaa
atacgcacgggcagcactctcaccattccagcaacggtccgcggctatccacaacccacc
gtgacctggcacaaggagacggtggagcaaaagaccaccaagacggtcactatcgagaca
accgagaccacttccacctacactgtgaagaaggtcacccgcgagttctccggcaaatac
aaggtcacggccaccaacgaatccggatctacgtatgtggaatgcacggttcaggtgatc
gacaagcccagcagacctcagtccctggagattaaggatgttaaaaaggactcgatcacc
ttggagtggacgccgcccatcgatgatggcggtttggagatcaataaatatatcctggag
aagtgtgatgttcagaacaatgtctggatgaaggtttccgactttgacaagaccataaaa
tcctatgcggttcagaaattatcgatgaattcgcaatacatgttccgtgtggtggccgcc
aatccaattggcgaatcagagcccacggaaagtgatcctgtgactataactaagaagttt
gaaaaaccatcgccaccacgtggccccacgactgtatcgggaatgaacgacacatccttt
aatttggcttgggaaccatccgagaacgacggtggctccaaaatcattgagtacattgtg
gaaatacgggaagagactgaaaccatctatagatcggtgggcactagcctgggcactgtc
accaatattcacgtggagaaggtggtcaggaataagggctatctgttccgcatttatgcg
agaaacgaggctggcactagcgaggcgtacgagaccacggaaaagattgtcgtgggtcgc
aagataacgcctccatcgccacctcagaatctaagggcaccggatgttaccagtcgaagt
gttaccttggactgggaggtgccagcccgcaatggtggttccgaaatcacgggctactgc
gtggaaaaacgttcgtcaacatctacaacttggtcaaaggtcattacactggacgctcac
caactgcattacacgattgacaatttgaaggagaagtgcgagtactggttccgtgtgtct
gcggaaaatgaggctggattaggtgcaccagccgtcaccgagagcgtatcgctcaagaca
catgccaccgttccctcgccaccgaccgctccactggaggcgcgcgttcttgccgccaat
gcccatatcttcgaatggggtattcccgagtcagatggaggtgcgcctctgctcggttac
cacatcgcgataagggacatgaagaagaccatgtggatcgaggtgggtcgtgtgccagct
ggcgtgcagaaattccagatcagagacctgcaggagaatcacgagtatatgattcgcata
tttgccaagaacgagattggtctgagtgaacctctagagtcagaggagccctacaaggtt
atgaccgctggtcatgagagcctgccggacgagccgcgcaccgagatgagcacgtgcaat
acttcgtcgtggctgcgtgaccacaacatggatgcagacatccattcgtatgcgcgcggc
aggctgcttcaacgcgatgagtacttcttccgactgtgggcggagatacccaagagcaaa
aagaagaagagctccaaatag

DBGET integrated database retrieval system