KEGG   Drosophila serrata: 110188838Help
Entry
110188838         CDS       T06108                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dsr  Drosophila serrata
Pathway
dsr03040  Spliceosome
dsr04141  Protein processing in endoplasmic reticulum
dsr04144  Endocytosis
dsr04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110188838
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110188838
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110188838
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110188838
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dsr01009]
    110188838
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dsr03041]
    110188838
   03009 Ribosome biogenesis [BR:dsr03009]
    110188838
   03110 Chaperones and folding catalysts [BR:dsr03110]
    110188838
   04131 Membrane trafficking [BR:dsr04131]
    110188838
   03051 Proteasome [BR:dsr03051]
    110188838
   03029 Mitochondrial biogenesis [BR:dsr03029]
    110188838
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsr04147]
    110188838
Protein phosphatases and associated proteins [BR:dsr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110188838
Spliceosome [BR:dsr03041]
 Complex B
  Other components
   Prp19 complex
    110188838
 Complex C
   Prp19-CDC5 complex
    110188838
Ribosome biogenesis [BR:dsr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110188838
Chaperones and folding catalysts [BR:dsr03110]
 Heat shock proteins
  HSP70 / DNAK
   110188838
Membrane trafficking [BR:dsr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110188838
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110188838
Proteasome [BR:dsr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110188838
Mitochondrial biogenesis [BR:dsr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110188838
Exosome [BR:dsr04147]
 Exosomal proteins
  Proteins found in most exosomes
   110188838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl BcrAD_BadFG FGGY_C PG_binding_4 DDR DUF4824
Motif
Other DBs
NCBI-GeneID: 110188838
NCBI-ProteinID: XP_020814394
Position
Unknown
AA seq 642 aa AA seqDB search
MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA
MNPNNTIFDAKRLIGRRFDDATVQADMKHWPFEVVSENGKPRIRVEYKGERKSFYPEEVS
SMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
IAYGLDKQGTSERNVLIFDLGGGTFDVSVLTIEDGIFEVKATAGDTHLGGEDFDNRLVNH
FVQEFQRKHKRDLGQNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTAVTRA
RFEELNGDLFRGTMEPVAKALRDAKMDKGQIHDIVLVGGSTRIPKVQRLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILHGDKSEAVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTI
PTKQTQIFTTYADNQPGVLIQVFEGERAMTRDNNNLGKFELSAIPPAPRGVPQVEVTFDI
DANGILNVSALEKSTGKENRITITNDKGRLSKEDIERMVNDAEAYRQADDEQRERVNAKN
QLESYCFQLRSTLDDEQLRSRISDTDRETIQQRCNETIAWLDANQLAERQEFEHKQQELE
RICSPIITRLYQGAGMPTSPPSAGGPNPGPTGGSGPTIEEVD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaattaccagcggttggcattgaccttggtaccacgtactcgtgtgtcggcgtc
tttcagcatggcaaggtggagatcatagccaacgatcagggcaaccgcaccacgcccagc
tatgtggcgttcacggagtcggagcgtctcataggcgatgcggccaagaatcaggtggcc
atgaatcccaacaatacgatcttcgatgccaagcggttgattggccgccgcttcgatgac
gccaccgtgcaggcggacatgaagcactggcccttcgaggtggtctccgagaacggcaag
ccgaggatccgtgtggagtacaagggcgaaaggaagagcttctatccagaggaggtgtcc
tcgatggtgctgaccaagatgcgcgagacagccgaggcgtatctgggtggaactgtgacg
gatgcggtggtcactgtgcccgcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgccatcgccggcctgaacgtgctccggatcatcaacgagcctacggcggcggcc
attgcctatggcttggacaagcagggcaccagcgagcggaatgtcctgatcttcgatctg
ggcggcggcaccttcgacgtgtccgtgctgaccattgaggatggtatcttcgaggtgaag
gccactgctggggacacgcatcttggtggcgaggactttgacaaccggctggtgaatcat
ttcgtgcaggagttccagcgcaagcataagcgtgatcttggccagaataaacgagctctg
aggcgcctgcgcaccgcctgtgagcgggccaagcggacgctgtcctcctccacacaggcc
agcatcgagatcgactccctgttcgaaggcatcgacttttacaccgcggttacgcgtgcc
cgcttcgaggagctcaacggggatctcttccggggcaccatggagccggtggctaaggcg
ctacgtgacgccaaaatggacaagggtcagattcatgacattgtgctcgttggtggctct
acaaggatacccaaggtgcaacgccttctgcaggacttcttcaacggcaaggaactgaac
aagtccatcaatcccgacgaggcagtggcttacggtgccgccgttcaggcagccattctg
catggcgacaagtcagaggctgtgcaggatctgctcctgctcgatgtgacgccgctgtcc
ttgggcattgagaccgctggcggagtgatgaccacgttgatcaagcggaacaccaccata
cccacgaagcagacgcagatctttaccacttatgcggacaatcagccaggtgtactcatc
caggtgttcgagggcgagagggctatgacccgcgacaataacaatctcggcaagtttgag
ctctcggccattccgccggcacctcgaggagtgccccaggtggaggtcaccttcgatatc
gatgccaatgggatactcaatgtgtcggctctggagaagtcgacgggcaaggagaaccgc
atcaccatcaccaatgacaagggtcggctgagcaaggaggacattgagcggatggtcaac
gatgcggaggcttatcggcaggcggacgatgagcagcgcgagcgggttaatgccaagaac
caactggagtcatactgtttccagctgcgctccaccctggatgatgaacaactgcgctcc
aggattagtgacaccgatcgggagaccatacagcagcgctgcaacgagaccatcgcctgg
ctggatgccaatcagctggccgagcggcaggagttcgagcacaaacagcaggagctggaa
cgcatctgcagtccgatcatcacgaggttatatcagggtgccggcatgcctacgtctcca
ccttcagccggtggtccaaatccgggaccaaccggcgggtctggccccaccattgaggag
gtggactag

DBGET integrated database retrieval system