KEGG   Drosophila serrata: 110191973Help
Entry
110191973         CDS       T06108                                 

Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
dsr  Drosophila serrata
Pathway
dsr00600  Sphingolipid metabolism
dsr01100  Metabolic pathways
Module
dsr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110191973
Enzymes [BR:dsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     110191973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 110191973
NCBI-ProteinID: XP_020818653
Position
Unknown
AA seq 659 aa AA seqDB search
MTAKTEINLLDPNSQEQEQVTTPGTSISTASEAEMEIETETETGVCAKTNELSEIFFVDN
NRRKQSIKIQVKLCPEGVYLRRETDEDDHINEQLIRIDDIIGSRFGPRLRKRARGGLNSC
KNPNVQTEEASPEPDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSHDYAVNLNTAEQ
WHRTIRQHKRGSAGCSASSHIGDSSKQLLILLNPKSGSGKGRELFQKQVAPLLSEAEVQY
DLQITTHPQYAKEFVRTRKDLLERYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLG
IIPCGSGNGLAKSVAHHCNEPYEPKPILHATLTCIAGKSTPMDVVRVEIAARDKHYVMYS
FLSVGWGLIADIDIESERLRSIGAQRFTLWAIRRLITLRTYKGKVYYQLPNKITKVEQAK
EAKEITKKSANFTPTSNANSKAEASEFHDLPEEEEGEEDAEHFSDAISLDRSVYRQNADS
WHSAMSRRTAYYSLGGPSLRSNRSRMSINQRIEAANAEFSELVPSGTIPGLNMPLESKDG
WICEEGDFVMVHAAYTTHLSSDVFFAPESRLSDGLIYLVIIRSGVSRHQLLNFMLSLNTG
THLPIGEDPFIKVVACRAFRIEPQTSDGILVVDGERVDYGPIQAEVMPGLINVMTTNGQ
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaaaacggagattaatttactggatccgaatagtcaggagcaggagcaagtc
actacaccgggaacatccatatccacagcctccgaagcggaaatggaaattgaaacggaa
acggaaacgggagtgtgtgccaagaccaatgaacttagcgaaatcttctttgtggataat
aatcgtagaaagcagagcattaaaatccaggttaaactctgtccggagggtgtctatttg
cgacgtgaaacggatgaagatgatcatatcaatgagcagttaatcaggatcgatgatatc
attggttcccgctttggaccgcgtttaaggaaacgtgcccgcggtggcctcaactcctgc
aagaatcccaatgtccaaacggaagaggcttcaccggaaccggatagtgataatagcgcc
tatctctatatatatgcttatttgaagaaggagaaacccttgaggagagttcagaccctc
aggatactacgctttcgttctagccatgattatgcagttaatttaaacactgccgaacaa
tggcatcgaactataaggcaacataagagaggcagtgctggatgcagtgcctccagtcac
attggtgattccagcaaacaattactgatactcctaaatcccaaatccggttccggcaag
gggcgagagctctttcagaagcaagtggccccgctgctcagcgaggcagaggtccaatat
gatttacaaataaccacacatccgcaatatgccaaggaatttgtacgaactagaaaggat
ctgctggaacgttattctggcattgtggtggcctctggcgatggtctcttctacgaggta
ctcaatggtcttatggaacgcatggattggagaagggcttgcagggagctacccttgggc
attataccctgtggctctggcaatggtttggccaaaagtgtagcccatcattgcaatgaa
ccctatgaacccaaacccattctacatgccactctcacctgcattgccggcaagagcaca
cccatggatgtggttcgagttgagattgcagccagggataagcattatgtaatgtattcc
tttttatcggtgggttggggtcttatagccgatattgacattgaaagcgaacgcttgaga
tcaattggagcccagagatttaccctttgggccataagacgtttaataacattgaggaca
tacaagggcaaggtttattaccaattgcccaataaaataactaaagtggagcaggccaag
gaagccaaggaaataactaaaaaatctgccaactttacacccacttcaaatgctaattcc
aaggcagaagccagtgagtttcatgatttacccgaggaagaggaaggggaagaggatgct
gaacacttctctgatgccatatccctggatagatctgtgtaccgacaaaatgccgatagc
tggcactcggccatgtcaagaagaaccgcctattattcgctgggtggtcccagtcttcgt
tcaaatcgcagtcgaatgagtataaatcaacgtattgaggcagcaaatgctgaattttcg
gaattggtgccatcgggcactattcccgggttgaatatgccattggagtccaaggatggt
tggatctgtgaggaaggtgactttgtgatggtacatgctgcctataccacacacttgtct
tcggatgtcttctttgccccggaatcccgactgagcgatggacttatctatctggtgatc
atccgtagtggagtgagtcgccatcaattgttgaactttatgttgagtttaaataccggc
acccatctgcccatcggtgaggatcccttcatcaaggtggtggcctgcagagcgttccgt
atcgaaccccagacctccgatggcattctggtggtcgatggcgaacgtgttgactatgga
cccattcaggcggaggtaatgccgggtctgattaatgtaatgaccaccaatggtcagtga

DBGET integrated database retrieval system