KEGG   Dechlorosoma suillum: Dsui_0011Help
Entry
Dsui_0011         CDS       T01657                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00630  Glyoxylate and dicarboxylate metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01200  Carbon metabolism
Module
dsu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dsui_0011
Enzymes [BR:dsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Dsui_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEV24436
UniProt: G8QKP8
Position
9345..10655
Genome map
AA seq 436 aa AA seqDB search
MSTREQQIAALEKDWAENPRWKGVKRGYSAADVVRLRGSLQPEYTFAQRGAKVLWEKVNG
GAKKGYVNAFGAITAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLYAYDSVPT
MVRRINNTFKRADEIQWSRGINPGDKEFIDYFLPIVADAEAGFGGVLNAFELMKNMIAAG
AAGVHFEDQLAAAKKCGHMGGKVLVPTREAVEKLISARFAADVMGVPTLILARTDAEAAN
LITSDYDANDKPFLTGERTQEGFFRVKNGLEQSISRGVAYAPYADLVWCETGVPDIGFAR
EFAQAVHAACPGKLLSYNCSPSFNWKKNLNDSQIASFQEELSALGYKYQFITLAGIHVNW
YNTFKFAKAYAGGEGMKHYVEMVQEPEFAAREDGYTFVSHQQEVGTGYFDDVTTVIQGGS
SSVKALTGSTEEEQFH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcgcgaacagcaaatcgccgccctggaaaaagactgggctgagaacccccgt
tggaagggcgtcaagcgtggttattccgctgctgacgtggttcgtctgcgcggctccctg
cagcccgagtacaccttcgcccagcgcggtgccaaggtcctctgggaaaaggtcaacggc
ggcgccaagaagggctacgtgaatgctttcggcgccatcaccgccggtcaagccatgcaa
caggccaaggccggcctggaagccgtgtatctgtccggctggcaggttgctgccgacggc
aacacctctgaaaccatgtacccggaccagtccctgtatgcctacgactccgtccccacc
atggttcgccgcatcaacaacaccttcaagcgtgctgacgaaatccagtggtcccgcggc
atcaaccccggcgacaaggaattcatcgactacttcctgcccatcgtggccgacgctgaa
gccggtttcggcggcgtgctgaacgccttcgaactgatgaagaacatgatcgccgccggc
gccgccggtgtgcacttcgaagaccagctggctgccgccaagaagtgtggccacatgggt
ggcaaggtgctggtgccgacccgcgaagccgtggaaaagctgatctccgcccgtttcgcc
gctgacgtcatgggcgtgccgaccctgatcctggcccgtaccgatgccgaagctgccaac
ctgatcacctccgactacgacgccaacgacaagcccttcctcaccggcgaacgtacccag
gaaggcttcttccgcgtcaagaacggtctggaacagtccatctcccgcggcgttgcctac
gctccctacgccgatctggtgtggtgcgaaaccggcgtgcccgacatcggcttcgcccgt
gaattcgcccaggccgtgcatgctgcctgccccggcaagctgctgtcctacaactgctcc
ccgtccttcaactggaagaagaacctcaacgacagccagatcgcttccttccaggaagaa
ctgtccgccttgggctacaagtaccagttcatcaccctggccggcatccacgtcaattgg
tacaacaccttcaagttcgccaaggcctacgccggcggcgaaggcatgaagcactacgtg
gaaatggtgcaggagcccgaattcgccgcccgcgaagacggctacaccttcgtttcccac
cagcaggaagtgggcaccggctacttcgacgacgtgaccaccgtgatccagggcggctcc
tcctccgtcaaggccctgaccggttccaccgaagaagaacagttccactaa

DBGET integrated database retrieval system