KEGG   Dechlorosoma suillum: Dsui_0019Help
Entry
Dsui_0019         CDS       T01657                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00620  Pyruvate metabolism
dsu00630  Glyoxylate and dicarboxylate metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01200  Carbon metabolism
Module
dsu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dsui_0019
   00630 Glyoxylate and dicarboxylate metabolism
    Dsui_0019
Enzymes [BR:dsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dsui_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEV24444
UniProt: G8QKQ6
Position
16558..18156
Genome map
AA seq 532 aa AA seqDB search
MSLNLPAGMQITAPIQPQYESILTLEALEFVAKLHRAFEGRRQELLKARVERQARIDAGE
MPDFLPETKHIREGDWKVAPLPAALERRRTEITGPVEAKMIINAFNSGADSYMTDFEDSN
SPNWDNQIQGQVNLYQAIRRQLSFKNEAGKEYKLNDQIATLQIRPRGWHLDEKHVTVDGQ
RVAGGIFDFALVFFHNAKEQIARGAGPFYYLPKMESHLEARLWNDIFVMAQDHIGLPQGT
IKATVLVETILATFEMEEILYELRNHSAGLNAGRWDYIFSCIKKFKKNKDFCLAQRGVIT
MEVPFMRSYALALVQACHKRGAPAMGGMSALIPIKNDPVANEKALAGIRHDKARDAKDGF
DGGWVAHPGLVSIAHEEFVKVLGDKPNQWEKQVEGSFGPKDWLNFQPEQPITEAGLRNNI
NVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWVVSPKGILDDGRKVTVEMVRP
MIAEELAKVKATVAAQGEDTATYDQAAVIFDKMSLTPDYPEFLTLPLYEAMA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaacctgcccgccggtatgcaaatcaccgctcccatccagccccagtacgaa
agcatcctcaccctggaggccctggagttcgtcgccaagctgcaccgcgccttcgaaggc
cgccgccaggaactgctgaaggcccgcgtcgagcgccaggcccgcatcgatgccggcgag
atgcccgacttcctgcccgagaccaagcacattcgcgagggtgactggaaggtcgcccct
ttgcccgccgccctggagcgtcgccgcaccgaaatcaccggcccggtcgaagccaagatg
atcatcaacgccttcaactccggcgctgattcctacatgaccgacttcgaggattccaac
tcccccaactgggacaaccagatccaggggcaggtcaacctctaccaggccatccgccgc
caactctccttcaagaacgaagccggcaaggaatacaagctcaacgaccagatcgccacc
ctgcagatccgtccccggggctggcacctggatgaaaagcacgtgaccgtggacggccag
cgcgtcgccggcggcatcttcgacttcgccctggtcttcttccacaacgccaaggaacag
atcgcccgcggcgccggccccttctactacctgccgaagatggaatcccatctggaagcc
cgcctgtggaacgacatcttcgtcatggcccaggaccacatcggcctgccccaaggcacc
atcaaggccaccgtgctggtggaaaccatcctcgccaccttcgagatggaagagatcctc
tacgaactgcgcaaccactccgccggtctgaacgccggccgttgggactacatcttctcc
tgcatcaagaagttcaagaagaacaaggacttctgcctggcccagcgcggcgtcatcacc
atggaagtgcccttcatgcgctcctacgccctggccctggtgcaggcctgccacaagcgc
ggcgcccctgccatgggcggcatgagcgccctgatccccatcaagaacgacccggtggcc
aatgagaaggccctggccggcatccgccacgacaaggcccgcgatgccaaggacggcttc
gacggcggctgggtggcccaccccggtctggtttccatcgcccacgaagagttcgtcaag
gtcctgggcgacaagcccaaccagtgggaaaagcaggtggaaggctccttcggtcccaag
gactggctcaacttccagcccgagcagcccatcaccgaagccggcctgcgcaacaacatc
aacgtcggtatccactacctgggttcctggctggccggcaacggctgcgtgcccatccac
aacctgatggaagatgcggccaccgccgaaatctcccgctcccaggtgtggcagtgggtg
gtctctcccaagggcatcctggacgacggccgcaaggtcaccgtggaaatggtgcgcccc
atgatcgccgaggaactggccaaggtgaaggccaccgttgcagcccagggcgaagacacc
gccacctacgaccaggccgccgtgatcttcgacaagatgagcctgaccccggactatccg
gagttcctcaccctgccgctgtacgaagccatggcctaa

DBGET integrated database retrieval system