KEGG   Azospira oryzae: Dsui_0072Help
Entry
Dsui_0072         CDS       T01657                                 

Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
dsu  Azospira oryzae
Pathway
dsu00520  Amino sugar and nucleotide sugar metabolism
dsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dsui_0072
Enzymes [BR:dsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     Dsui_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind NAD_binding_4 WRC
Motif
Other DBs
NCBI-ProteinID: AEV24496
UniProt: G8QLG7
Position
complement(68445..69509)
Genome map
AA seq 354 aa AA seqDB search
MNRGFWSGKRVFLTGHTGFKGGWLALWLADMGAEVHGYALNPPTSPALFNVAGVGDRMAS
SVIADVRDGERLARAVADVAPEVVFHLAAQPLVRHSYKAPVETYAVNVMGTINLLEAVRH
CASVKVLVNVTTDKCYENREWVWAYREHEAMGGHDPYSSSKACSELVTASYRNSFLAQRQ
VQVATARAGNVIGGGDWAEDRLLPDFLRALDAGRELVIRSPAAIRPWQHVLEPLSGYLTL
AEQLQQQGPALAEGWNFGPNEIDARPVRWIVDFLCQRTPGAAWRCDEAAQPHEAGSLKLD
SAKAKALLGWRPRWNLAKALEMTIDWHQAWKGSGDMAAHTLAQIRQYEMSALSS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtggtttctggtccggcaagcgcgtctttttgaccggacataccggtttcaaa
ggtggatggctggcactgtggctggcggatatgggagctgaggtccatggctatgcattg
aatccgccaacctcgccggcattgttcaatgtggcaggggtgggcgatcgcatggccagc
agtgtcattgccgatgtgcgggacggggagcgtctggcgcgggcagttgcggatgttgcg
ccggaagtggtgtttcaccttgcagcgcaaccgttggtgcgtcactcctacaaggcaccg
gttgaaacttacgccgtcaacgtcatgggcacgatcaatctcctggaggccgtgcgtcat
tgcgccagcgtcaaggtattggtcaatgtcactaccgacaagtgctatgaaaaccgggag
tgggtttgggcctatcgtgaacatgaggccatgggagggcacgacccctattcgagcagc
aaagcgtgttccgagttggtgacggcatcctatcgtaattccttcctggcccagcggcag
gttcaggttgccacggcccgggccggaaatgtcatcggaggcggcgattgggctgaggac
cggctgttgccggatttcctccgcgctcttgatgccggccgcgaactggtcatccgttct
cctgcggccatccggccctggcagcatgtgctggagcccctttcaggttatctgacgctg
gccgaacaactgcagcagcaaggcccggcgcttgccgaggggtggaattttggccccaac
gagattgatgcccgccctgtacgctggattgtggatttcctgtgccagcgtacgccggga
gctgcctggcgttgcgatgaggccgcccagccccacgaggctggcagcttgaaactggat
agtgccaaggccaaggccctccttggctggcgcccccgctggaaccttgccaaagccctg
gaaatgaccatcgactggcaccaggcgtggaaaggcagcggggacatggctgcccatacg
ctggcccagattcgccagtatgaaatgtctgcgttgtcgtcatga

DBGET integrated database retrieval system