KEGG   Dechlorosoma suillum: Dsui_0325Help
Entry
Dsui_0325         CDS       T01657                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00071  Fatty acid degradation
dsu00072  Synthesis and degradation of ketone bodies
dsu00280  Valine, leucine and isoleucine degradation
dsu00310  Lysine degradation
dsu00362  Benzoate degradation
dsu00380  Tryptophan metabolism
dsu00620  Pyruvate metabolism
dsu00630  Glyoxylate and dicarboxylate metabolism
dsu00640  Propanoate metabolism
dsu00650  Butanoate metabolism
dsu00900  Terpenoid backbone biosynthesis
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01130  Biosynthesis of antibiotics
dsu01200  Carbon metabolism
dsu01212  Fatty acid metabolism
dsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dsui_0325
   00630 Glyoxylate and dicarboxylate metabolism
    Dsui_0325
   00640 Propanoate metabolism
    Dsui_0325
   00650 Butanoate metabolism
    Dsui_0325
  Lipid metabolism
   00071 Fatty acid degradation
    Dsui_0325
   00072 Synthesis and degradation of ketone bodies
    Dsui_0325
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dsui_0325
   00310 Lysine degradation
    Dsui_0325
   00380 Tryptophan metabolism
    Dsui_0325
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dsui_0325
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dsui_0325
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dsui_0325
Enzymes [BR:dsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dsui_0325
Exosome [BR:dsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsui_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEV24743
UniProt: G8QNF0
Position
complement(329771..331069)
Genome map
AA seq 432 aa AA seqDB search
MAQQQAFEPVYVVDGARTPFLKAKNGPGPFSAADLAVQAGRALLARQPFAPEDLDEVVLG
CASPSPDEVNIGRVAALRLGCGNKVTGWTVMRNCASGMQALDSAMANIQSGRSELVLAGG
VDALSRAPLLYNDAMVLWFAGMMQMKTLGQKAGHFLKLRPSVLLNPVIGLMKGLTDPVVG
LLMGQTAENLAWRFGISREEMDAFSVRSHQRVMAGRAKQAFGEIVPLVGNDGTVYAEDDG
VRVDASMDGMKKLKPFFDKKYGRVTPANSSQITDGGAWLLLASESAVKRWKLEPLGRIVD
AQWAGLDPSQMGLGPVHAVTPILQRHGLGLNDVDLMEINEAFAAQVLGCLKAWEDDAYCR
EELGLPGALGSLDQDKLNVDGGAVAQGHPVGASGARIVLHLLHALKARGGKRGVASICIG
GGQGGAMLVETC
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcagcaagcatttgagccggtctacgtggtggatggggcacgcaccccgttc
ctcaaggcgaagaacgggcccggcccgttctcggccgccgatcttgccgtgcaggccggg
cgggcccttctggcccgccagcccttcgccccggaggatctggacgaggtggtgctgggc
tgtgccagccccagcccggacgaggtgaatatcggccgggtggcagccctgcgcctgggc
tgcggcaacaaggtgacgggctggacggtgatgcgcaactgcgcctccggcatgcaggcc
ctggattcggccatggccaacatccagtccggccgttccgaactggtcctggccggcggc
gtggatgccctgtcccgggcgcccctgctctacaacgacgccatggtgctgtggttcgcc
ggcatgatgcagatgaagaccctgggccagaaggccgggcacttcctcaagctgcgcccc
agcgtgctgctcaatccggtgatcggcctgatgaagggcctgaccgacccggtggtgggc
ctcttgatgggccagacggcggaaaacctggcctggcgcttcggcatcagccgggaagag
atggatgccttttccgtgcgctcccatcagcgggtcatggccggccgggccaagcaggcc
ttcggcgagatcgtgcccctggtgggcaacgacggcaccgtctatgccgaggacgatggc
gtgcgggtcgatgccagcatggacgggatgaagaagctcaagcccttcttcgacaagaaa
tacggccgggtcactccggccaacagttcccagatcaccgacggcggcgcctggctgctg
ctggcttccgaaagtgccgtcaagcgctggaagctcgagcccctgggccgcatcgtggac
gcccagtgggccggcctcgatccttcccagatgggcctgggcccggtgcatgcggtgacc
cccatcctgcagcgtcacggcctggggctcaacgatgtggacctgatggaaatcaacgag
gccttcgctgcccaggtgctgggctgcctcaaggcctgggaagacgatgcctactgccgc
gaggaactgggcctgcccggcgccctgggcagcctggaccaggacaagctcaacgtggat
ggcggcgccgtggcccagggccatccggtgggcgcctccggcgcccgcatcgtgctgcac
ctgttgcatgccctgaaagcccggggcggcaagcggggcgtcgccagcatctgcatcggc
ggcggccagggcggtgccatgctggtggaaacctgctga

DBGET integrated database retrieval system