KEGG   Azospira oryzae: Dsui_0354Help
Entry
Dsui_0354         CDS       T01657                                 

Definition
(GenBank) ribosomal protein L22, bacterial type
  KO
K02890  large subunit ribosomal protein L22
Organism
dsu  Azospira oryzae
Pathway
dsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dsui_0354
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dsu03011]
    Dsui_0354
Ribosome [BR:dsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dsui_0354
  Bacteria
    Dsui_0354
  Archaea
    Dsui_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 RuvA_C
Motif
Other DBs
NCBI-ProteinID: AEV24772
UniProt: G8QNX3
Position
complement(352340..352669)
Genome map
AA seq 109 aa AA seqDB search
METRAILRGVRLSAQKGRLVADLVRGKPVGQALNILGFAPQKGAKIVKKVLESAIANAEH
NDGADIDELKVKTIHVEQGTSLKRFTARAKGRGNRIIKQTCHIFVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcgtgctattttgcgcggcgtccgcctctccgcccagaagggtcgcctcgtg
gctgacctggttcgcggtaagccggtgggccaggcgctcaacatcctgggctttgctccc
caaaagggcgcaaagatcgttaagaaggttctggagtctgccatcgccaacgccgagcat
aatgacggcgccgatatcgacgaactgaaggtcaagaccattcacgtcgaacagggtacg
tctctgaagcgcttcaccgctcgggcgaagggtcgtggcaatcgcatcatcaagcagacc
tgccacattttcgtgaccgtcgggaactga

DBGET integrated database retrieval system