KEGG   Azospira oryzae: Dsui_0762Help
Entry
Dsui_0762         CDS       T01657                                 

Definition
(GenBank) formyltetrahydrofolate deformylase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
dsu  Azospira oryzae
Pathway
dsu00630  Glyoxylate and dicarboxylate metabolism
dsu00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dsui_0762
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dsui_0762
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     Dsui_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ACT DUF5358
Motif
Other DBs
NCBI-ProteinID: AEV25171
UniProt: G8QH79
Position
763287..764147
Genome map
AA seq 286 aa AA seqDB search
MHRQRYYTLTASCPDRVGIVAKVSGFFAAHQGWILETALHADDTAGRYFMRIEVRADSLP
FHLAELRERFRPVAEELGMEWKISDSAVKKRVVVLVSKQEHCLYDLLSRWQSKELDIEIP
CIISNHDTFRGFVEWHGIPFHHIPVTADNKAAAYAEIQRLYEEVKGDTMVLARYMQILSP
ELCAAYPGQILNIHHSFLPSFVGAKPYHQAYERGVKLIGATCHYVTADLDQGPIIDQDVI
RIDHSDSVEDMVRYGKDIEKTVLARGLRYHLEDRVLVHGNKTVVFR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgccagcgctactacaccctgaccgcctcctgccccgaccgggtgggcatcgtc
gccaaggtttccggtttcttcgccgcccaccagggctggattctcgaaaccgccctccac
gccgacgacacggcgggccgctacttcatgcgcatcgaggtgcgggccgactccctgccc
ttccacctggccgagctgcgggagcgcttccgccccgtcgccgaggaactgggcatggag
tggaagatcagcgacagcgccgtgaagaagcgcgtggtggtgctggtttccaagcaggag
cactgcctctacgacctgctctcccgctggcagtccaaggaactggacatcgagattccc
tgcatcatctccaaccacgacaccttccgcggtttcgtcgagtggcacggcatccccttc
caccacatcccggtgacggcggacaacaaggccgccgcctacgccgaaatccagcgcctg
tacgaggaagtgaagggcgacaccatggtgctggcccgctacatgcagattctctcgccc
gagctgtgcgccgcctatccggggcagatcctcaacatccaccacagcttcctgcccagc
ttcgtcggcgccaagccctaccaccaggcctatgaacggggcgtcaagctgatcggcgcc
acctgccactacgtcaccgccgacctggaccagggccccatcatcgaccaggacgtgatc
cgcatcgatcactccgactcggtggaggacatggtgcgctacggcaaggacatcgaaaaa
accgtgctggcccggggcctgcgctaccacctggaagaccgggtgctggtgcacggcaac
aagacggtggtgttccgctga

DBGET integrated database retrieval system