KEGG   Azospira oryzae: Dsui_0779Help
Entry
Dsui_0779         CDS       T01657                                 

Definition
(GenBank) 5-methyltetrahydrofolate--homocysteine methyltransferase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
dsu  Azospira oryzae
Pathway
dsu00270  Cysteine and methionine metabolism
dsu00450  Selenocompound metabolism
dsu00670  One carbon pool by folate
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01230  Biosynthesis of amino acids
Module
dsu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dsui_0779
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dsui_0779
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dsui_0779
Enzymes [BR:dsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Dsui_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Met_synt_B12 S-methyl_trans Pterin_bind B12-binding_2 B12-binding AIRC
Motif
Other DBs
NCBI-ProteinID: AEV25186
UniProt: G8QHN5
Position
783472..787152
Genome map
AA seq 1226 aa AA seqDB search
MQPDRSSELSALLQQRLLILDGAMGTMIQRHGLTEKDYRGTRFADHAHDLKGNNDLLLLT
RPEVIRGIHAEYLAAGADILETNTFNATKVSQADYKLEAIVYELNVAGARLAREVCDEFT
AKNPAKPRFVAGVLGPTSRTASISPDVNDPGYRNVTFDELVENYLEAIRGLTDGGADILL
VETVFDTLNAKAALFAIETFFDKVGRRWPVMISGTITDASGRTLSGQTAEAFWNSLNHIR
PLSFGLNCALGAKELRQYVEELSRVCDCFVSAHPNAGLPNAFGGYDETPEQLAEEIADWA
RHGFVNIVGGCCGTSPDHIAAIAKMVAGIAPRAIPAIEPQLRLSGLEPFNVGPDSLYVNV
GERTNVTGSKAFARMILEGRYDDALAVARQQVENGAQVIDINMDEAMLDSVAAMEKFLKL
IASEPDISRVPIMLDSSKWEVIETGLKCIQGKGIVNSISMKEGEAKFLEQAKLARRYGAA
VIVMAFDEKGQADTYARKTEICKRAYDLLVGIGFPAQDIIFDPNIFAIATGIEEHDNYAV
DFINATRWIRENLPHAQISGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMTMGIVNAG
MLGVYDDLEPELRQKVEDVVLNRHPGAGEALVEFAQTVKEGKAKDTGPDLTWRTLPVEKR
LEHALVKGITEFVVADTEEVRAALAAAGKPPLAVIEGPLMNGMNTVGDLFGAGKMFLPQV
VKSARVMKQAVAHLIPYIEEEKARTGASSKGKIVIATVKGDVHDIGKNIVGVVLGCNGYD
VVDLGVMVPTEKILHAAKEHGAQAIGLSGLITPSLEEMSHVASEMQRQGFNVPLLIGGAT
TSRAHTAIKIAPNYQAPVVYVPDASRAVGVVTSLLSEGQRESYAAEVAADYANIRQQHAG
KKGSAMVTLAEARANRLPWDATLVPTVPQKLGLQVLQDIDLATLAKYIDWGPFFQTWDLA
GRFPAILDDAVVGETARGVYADAQAMLKQIIEEKWLRAGAVFGLWPANAVGDDIVFYADE
QRSAPVLTWHGIRQQHKRPEDKANLCLSDYVAPKESGIADYAGAFAVTAGLGIEQKLAEF
EAAHDDYKSIMLKSLADRLAEACAEWLHQKVRKEDWGYAADEQLSNEQLIKEEYRGIRPA
PGYPACPDHTAKGGLFQLLQPEANIGMGLTESYAMTPAAAVSGFFLAHPQAQYFAIQKIG
QDQLEDWASRAGFTLEQAKRWLAPNL
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgaccgcagctccgaactctccgcccttctccagcagcgcctcctgatcctg
gacggcgccatgggcaccatgatccagcgccacgggctgaccgagaaggactaccgcggg
acccgcttcgccgaccacgcccacgacctgaagggcaacaacgacctgctgctgctgacc
cgccccgaggtcatccgcggcatccacgccgaatacctggcggccggcgccgatatcctg
gaaaccaacaccttcaacgccaccaaggtgtcccaggctgactacaagctggaagccatc
gtctacgaactgaacgtggccggcgccaggctggcccgggaagtgtgcgacgaattcacg
gcaaagaacccggccaagccccgcttcgtcgccggggtgctcggccccaccagccgcacc
gcctccatctctccggacgtgaacgatcccggctaccgcaacgtcaccttcgacgagctg
gtggaaaactacctggaagccatccgcggcctcaccgacggcggcgccgacatcctgctg
gtggagacggtgttcgacacgctgaatgccaaggccgccctgttcgccatcgagaccttc
ttcgacaaggtgggccgccgctggccggtgatgatctccggcaccatcaccgacgcctcc
ggccgcaccctctcgggccagaccgccgaggccttctggaactcgctgaaccacatcagg
cccctctccttcggcctcaactgtgccctcggcgccaaggaactgcgccagtacgtggag
gagctgtcccgggtgtgcgactgcttcgtctccgcccaccccaacgccggcctgcccaac
gccttcggcggctacgacgagaccccggagcagctggccgaggaaatcgccgactgggcc
aggcacggcttcgtgaacatcgtcggcggctgctgcggcacctcgccggaccacatcgcc
gccatcgccaagatggtggccggcatcgccccccgggccattccggcgatcgagccccag
ctgcgcctctccggcctggaacccttcaacgtcggccccgacagcctctatgtgaacgtg
ggcgagcgcaccaacgtcaccggctccaaggccttcgcccgcatgatcctggaagggcgc
tacgacgacgccctggccgtggcccgacagcaggtggaaaacggtgcccaggtcatcgac
atcaacatggacgaggccatgctggattccgtggccgccatggagaagttcctcaagctg
atcgcctcggagccggatatttcccgggtgcccatcatgctcgactcctccaagtgggag
gtgatcgagaccggcctcaaatgcatccagggcaagggcatcgtgaactccatttccatg
aaggaaggggaggccaagttcctggagcaggccaagctggcccgccgctacggtgccgcc
gtcatcgtcatggccttcgacgagaagggccaggccgacacctacgcgcgcaagaccgag
atctgcaagcgggcctacgacctgctggtcggtatcggtttcccggcccaggacatcatc
ttcgaccccaacatcttcgccatcgccacgggtatcgaggagcacgacaactacgcggtg
gacttcatcaacgccacccgctggattcgtgaaaacctgccccacgcccagatttccggc
ggcgtctccaacgtctccttctccttccgcggcaacgacccggtgcgggaagccatccac
accgtcttcctctaccacgccatccaggccggcatgaccatgggcatcgtcaacgccggc
atgctcggcgtgtacgacgacctggaaccggaactgcggcagaaggtggaagacgtggtg
ctgaaccgccaccccggcgccggcgaagcattggtggagttcgcccagacggtgaaggaa
ggcaaggccaaggacacggggccggacctcacctggcgcaccctgccggtggaaaagcgc
ctggaacacgccctggtcaagggcatcaccgaattcgtggtggccgacaccgaggaagtg
cgggccgccctggctgccgccggcaagccgcccctggccgtcatcgaaggccccctgatg
aacggcatgaacaccgtgggcgacctcttcggcgccggcaagatgttcctgccccaggtg
gtgaagtccgcccgggtgatgaagcaggccgtggcccacctcattccctacatcgaggaa
gagaaggcccgcaccggcgcctcctccaagggcaagatcgtcatcgccacggtcaagggc
gacgtgcacgacatcggcaagaacatcgtcggcgtggtgctgggctgcaacggctacgac
gtggtggacctgggggtgatggtgcccaccgagaaaatcctgcacgccgccaaggaacac
ggcgcccaggccattggcctctccggcctgatcacgccttccctggaggaaatgagccac
gtcgcttccgaaatgcagcgccagggcttcaacgtgcccctgctcatcggcggcgccacc
accagccgggcccacaccgccatcaagatcgcccccaactaccaggcaccggtggtctat
gtgccggatgcctcccgggccgtgggcgtggtcaccagcctgctctcggaaggccagcgg
gagagctacgccgccgaggtggccgccgactacgccaacatccgccagcagcacgccggc
aagaagggcagcgccatggtgaccctggccgaagcccgggccaaccgcctgccctgggat
gccaccctggtgccgacggtgccgcagaagctgggcctgcaggtgctgcaggacatcgac
ctggccaccctggccaagtacatcgactggggccccttcttccagacctgggacctggcc
ggccgcttccccgccatcctcgacgatgcggtggtgggcgagaccgcccggggcgtctat
gccgacgcccaggccatgctcaagcagatcatcgaggagaagtggctccgggccggtgcc
gtcttcggcctgtggccggccaatgccgtcggcgacgacatcgtcttctacgccgacgag
cagcgcagcgcgccggtgctgacctggcacggcatccgccagcagcacaagcggcccgag
gacaaggccaacctgtgcctctccgactacgtggcgcccaaggaaagcggcatcgccgac
tatgccggcgccttcgccgtcaccgccggcctgggcatcgagcagaagctggcggaattc
gaggcggcccacgacgactacaaatccatcatgctcaagtccctggccgaccgcctggcc
gaagcctgcgccgagtggctgcaccagaaggtgcgcaaggaggactggggttatgccgcc
gacgagcagctctccaacgagcagctgatcaaggaagagtaccgcggtatccgcccggcc
cccggctacccggcctgtcccgaccacaccgccaaaggcggcctgttccagctgctgcag
ccggaagccaacatcggcatgggcctcaccgagagctacgccatgacgccggctgccgcc
gtttccggcttcttcctggcccacccccaggcccagtacttcgccatccagaagatcggc
caggaccagctggaagactgggccagccgggccggcttcaccctggagcaggccaagcgc
tggctggcgcccaacctgtaa

DBGET integrated database retrieval system