KEGG   Dechlorosoma suillum: Dsui_1411Help
Entry
Dsui_1411         CDS       T01657                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00340  Histidine metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Dsui_1411
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dsui_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEV25806
UniProt: G8QNG1
Position
1468088..1469395
Genome map
AA seq 435 aa AA seqDB search
MSSVNIKRLNSADADFQQRLDELLAFEGAQDENIEKTVVGILADVKARGDAAVVEYTNRF
DRLSVAGMAALELPKAELQAALDGLPAERRAALEAAAQRIRTYHERQLGAGFTYTEADGT
MLGQMVTPLDRVGLYVPGGKAAYPSSVLMNALPAKVAGVKELIMVVPTPGGEHNALVLAA
ACLAGVDRVFTIGGAQAVAALAYGTETVPQVDKIVGPGNAYVACAKRRVFGIVGIDMVAG
PSEILVLADGSTDPDWVAMDLFSQAEHDELAQSILICPDAAYIEKVQASIDKLLPTMPRR
DVIRTSLENRGALILVRDLEEAVAMANRVAPEHLELSLAEPDAWVEKIHHAGAIFIGPYT
SESLGDYCAGPNHVLPTSGSARFSSPLGVYDFQKRTSLIRVSRAGAQTLGRIAATLADGE
GLPAHAQSARYRLDA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgtgaacatcaagcgcctgaacagcgccgacgccgatttccagcagcgcctc
gatgaactgctggccttcgagggcgcccaggacgagaacatcgaaaagaccgtggtcggc
atcctggccgacgtcaaggcccggggcgacgccgcagtggtggaatacaccaaccgcttc
gaccgtctctccgttgccggcatggccgccctggagctgcccaaggccgagctgcaggcc
gccctggacggcctccccgccgagcgccgggccgccctggaagcggctgcccagcgcatc
cgcacctaccacgagcgccagttgggtgccggcttcacctacaccgaagccgacggcacc
atgctcggccagatggtgacgcccctggaccgggtcggcctctacgtgcccggcggcaag
gccgcctatccctcctcggtgctgatgaacgccctgccggccaaggtggcgggggtcaag
gaactgatcatggtggtgcccacccccggcggcgagcataacgccctggtgctggcggcc
gcctgtctggccggcgtggatcgcgtcttcaccatcggcggcgcccaggccgtggccgcc
ctggcctacggcaccgaaaccgtgccccaggtggacaagatcgtcggtccgggcaacgcc
tacgtggcctgcgccaagcgccgggtgttcggcatcgtcggcatcgacatggtggccggc
ccctccgagatcctggtgctggccgacggctccacggacccggactgggtggccatggac
ctcttctcccaggccgaacacgacgagctggcccagtccatcctgatctgccccgacgcc
gcctacatcgagaaggtgcaggccagcatcgacaagctgctgcccaccatgccgcgccgc
gacgtgatccgcacctccctggaaaaccggggcgccctgatcctggtgcgggatctggaa
gaggccgtggccatggccaaccgggtggccccggaacacctggagctgtccctggccgag
cccgatgcctgggtggagaagattcaccatgccggcgccatcttcatcggcccctacacc
tccgagtccctgggcgactactgcgccggccccaaccacgtgctgcccacctccggcagc
gcccgcttctcctcgcccctgggggtctacgacttccagaagcgcaccagcctgatccgg
gtgtcccgggccggggcccagaccctgggccgcatcgccgccaccctggcggacggggag
ggcctgccggcccacgcccagtcggcccgctaccgtctcgatgcctga

DBGET integrated database retrieval system