KEGG   Dechlorosoma suillum: Dsui_1432Help
Entry
Dsui_1432         CDS       T01657                                 

Definition
(GenBank) chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu02020  Two-component system
dsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dsui_1432
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dsui_1432
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dsui_1432
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Dsui_1432
Two-component system [BR:dsu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Dsui_1432
Bacterial motility proteins [BR:dsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dsui_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg TAL_effector
Motif
Other DBs
NCBI-ProteinID: AEV25827
UniProt: G8QNI2
Position
complement(1486202..1487329)
Genome map
AA seq 375 aa AA seqDB search
MSLIKVMIVDDSAVVRQVVKQTLETDPSIKVLGAASDPLFAMEHMKREWPDVIVLDIEMP
RMDGLTFLKKIMAERPTPVVICSSLAEKGAEASMNALAAGAVGIITKPKMGLKQFLEDAS
SDLLGAVKAASRANVRKIITSTASGTSSHAERIANVAKGLNIAPKLSADAVISAGGLGSG
ASMVKTTDKIIAIGTSTGGTQALEAVLTKLPAVCPGIVIVQHMPEKFTAMFAERLNGLCQ
IEVREAKHGDRVIPGRALIAPGGKHMMLTRSGAQYTVEVVDGPLVNRHRPSVDVLFRSCA
KFAGRNALGIIMTGMGDDGARGLKEMVDAGADTVAEDESTCVVFGMPKEAIKLGAARTVL
PLNRIPEAIVAAGRG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatcaaagtcatgatcgtggacgattccgccgtggtgcggcaggtcgtcaag
caaacgctggaaaccgacccgagcatcaaggtgctgggcgccgcctccgaccccctcttc
gccatggagcacatgaagcgggaatggccggacgtgatcgttctggacatcgagatgccg
cgcatggacggcctcaccttcctcaagaagatcatggccgagcgtccgacgccggtggtg
atctgctcctccctggcggagaagggggccgaagcctccatgaacgccctggcggcgggg
gcggtgggcatcatcacaaaacccaagatgggcctcaagcagttcctcgaagacgcatcg
tccgacctgctcggcgccgtcaaggccgcctcccgcgccaatgtgcgcaagatcatcacc
tccacggccagcggcacctcctcccacgccgagcgcatcgccaatgtggccaagggcctc
aacatcgcccccaagctgtccgccgacgcggtcatctcggccggcggcctgggcagcgga
gcctccatggtcaagaccaccgacaagatcatcgccatcggcacttccaccggcggcacc
caggccctggaagccgtgctgaccaagctgccggccgtctgcccgggcatcgtcatcgtc
cagcacatgccggagaaattcaccgccatgttcgccgagcgcctcaacggcctgtgccag
atcgaggtgcgggaagccaagcacggcgaccgggtgatcccgggccgggccctcatcgcc
cccggcggcaagcacatgatgctgacccgcagcggcgcccagtacaccgtggaagtggtg
gacggccccctggtgaaccgccaccgcccctcggtggacgtgctgttccgctcctgcgcc
aagttcgccgggcgcaacgccctgggcatcatcatgaccggcatgggcgacgacggcgcc
cggggcctcaaggaaatggtggatgcgggggccgacacggtggcggaggacgaatccacc
tgtgtcgtcttcggcatgcccaaggaagccatcaagctgggggcggcgcgcaccgtgctg
cccctcaaccgcatcccggaagccattgtcgcggctggccgcggctga

DBGET integrated database retrieval system