KEGG   Dechlorosoma suillum: Dsui_1601Help
Entry
Dsui_1601         CDS       T01657                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00860  Porphyrin and chlorophyll metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dsui_1601
Enzymes [BR:dsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dsui_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEV25990
UniProt: G8QPT1
Position
complement(1681944..1682711)
Genome map
AA seq 255 aa AA seqDB search
MPLTGRTIVVTRPRAQADSLAQAIAAAGGTPLLYPLLEIEAADPAPLQAVAPRLADYAIV
FCVSPNAVEHALPTLLAAGPWPAGTRPAGVGTGTEKAWARFGLGQVIAPRERFDSEALLE
LPEFQAEAVAGKKVLILRGDGGRELLRETLEARGATVDVLTCYHRRPPSQGTAALEQAWT
AGRLDAIIISSSEALRHLWQLLDEDGRRRLAQTPLFVPHERIAQGAKDLGLQRVILTPPA
DQGLLAGLCAYNWAQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgaccggccgcaccatcgtcgtcacccggccccgggcccaggcggacagcctg
gcccaggccattgccgctgccggcggcactcccctgctctaccccctgctggaaatcgag
gccgccgacccggcgccgctgcaggccgtggccccccgtctggcggactacgccatcgtc
ttctgcgtcagtcccaatgcggtggaacacgccctgcccactctcctggcggccggcccc
tggccggcaggcacccgcccggccggcgtcggcaccggcacggaaaaggcctgggcccgc
ttcggcctgggccaggtcatcgcccccagggaacgtttcgactccgaggcattgctggaa
ctgccggaattccaggccgaggccgtggccggcaagaaggtgctgatcctgcgcggcgat
ggcggccgggagctgctgcgggaaaccctggaagcccggggcgccacggtggacgtgctc
acctgctaccaccgccgcccgccgagccagggcactgcagccctggaacaggcctggacc
gccggccgccttgatgccatcatcatctcctccagcgaagccctgcgccacctgtggcag
ttgctggacgaagacggccgccgccgcctggcccaaacgcccctgttcgtcccccacgag
cgcatcgcccagggggccaaggacctgggactgcaacgggtcatcctcacgccccctgcc
gaccagggcctattggccggcttatgcgcctataattgggctcaataa

DBGET integrated database retrieval system